Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NOTCH1 monoclonal antibody. Western Blot analysis of NOTCH1 expression in Raw 264.7.)

Mouse anti-Human, Mouse NOTCH1 Monoclonal Antibody | anti-NOTCH1 antibody

NOTCH1 (Notch 1, Neurogenic Locus Notch Homolog Protein 1, hN1, Translocation-associated Notch Protein TAN-1, TAN1) (FITC)

Gene Names
NOTCH1; hN1; AOS5; TAN1; AOVD1
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NOTCH1; Monoclonal Antibody; NOTCH1 (Notch 1; Neurogenic Locus Notch Homolog Protein 1; hN1; Translocation-associated Notch Protein TAN-1; TAN1) (FITC); anti-NOTCH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4G1
Specificity
Recognizes human NOTCH1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NOTCH1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa23-133 from human NOTCH1 (NP_060087) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NOTCH1 monoclonal antibody. Western Blot analysis of NOTCH1 expression in Raw 264.7.)

Western Blot (WB) (NOTCH1 monoclonal antibody. Western Blot analysis of NOTCH1 expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged NOTCH1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NOTCH1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-NOTCH1 antibody
Notch1 is a transmembrane protein functioning in development and the determination of cell fate. During maturation, the notch molecule is cleaved by a furin-like convertase at its extracellular domain. Upon binding to a ligand such as Delta1, or upon extracellular calcium depletion, the carboxy-terminal notch1 fragment is released and further cleaved between Gly1743 and Val1744. The resulting activated cytosolic fragment translocates to the nucleus where it activates transcription.
Product Categories/Family for anti-NOTCH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
neurogenic locus notch homolog protein 1 preproprotein
NCBI Official Synonym Full Names
notch receptor 1
NCBI Official Symbol
NOTCH1
NCBI Official Synonym Symbols
hN1; AOS5; TAN1; AOVD1
NCBI Protein Information
neurogenic locus notch homolog protein 1
UniProt Protein Name
Neurogenic locus notch homolog protein 1
UniProt Gene Name
NOTCH1
UniProt Synonym Gene Names
TAN1; Notch 1; hN1; NICD
UniProt Entry Name
NOTC1_HUMAN

NCBI Description

This gene encodes a member of the NOTCH family of proteins. Members of this Type I transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple different domain types. Notch signaling is an evolutionarily conserved intercellular signaling pathway that regulates interactions between physically adjacent cells through binding of Notch family receptors to their cognate ligands. The encoded preproprotein is proteolytically processed in the trans-Golgi network to generate two polypeptide chains that heterodimerize to form the mature cell-surface receptor. This receptor plays a role in the development of numerous cell and tissue types. Mutations in this gene are associated with aortic valve disease, Adams-Oliver syndrome, T-cell acute lymphoblastic leukemia, chronic lymphocytic leukemia, and head and neck squamous cell carcinoma. [provided by RefSeq, Jan 2016]

Uniprot Description

Notch 1: Functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. May be important for normal lymphocyte function. In altered form, may contribute to transformation or progression in some T-cell neoplasms. Involved in the maturation of both CD4+ and CD8+ cells in the thymus. May be important for follicular differentiation and possibly cell fate selection within the follicle. During cerebellar development, may function as a receptor for neuronal DNER and may be involved in the differentiation of Bergmann glia. Represses neuronal and myogenic differentiation. May enhance HIF1A function by sequestering HIF1AN away from HIF1A. Heterodimer of a C-terminal fragment N(TM) and an N- terminal fragment N(EC) which are probably linked by disulfide bonds. Interacts with DNER, DTX1, DTX2 and RBPJ/RBPSUH. Also interacts with MAML1, MAML2 and MAML3 which act as transcriptional coactivators for NOTCH1. The activated membrane-bound form interacts with AAK1 which promotes NOTCH1 stabilization. Forms a trimeric complex with FBXW7 and SGK1. Interacts with HIF1AN. HIF1AN negatively regulates the function of notch intracellular domain (NICD), accelerating myogenic differentiation. In fetal tissues most abundant in spleen, brain stem and lung. Also present in most adult tissues where it is found mainly in lymphoid tissues. Belongs to the NOTCH family.

Protein type: Receptor, misc.; Membrane protein, integral; Oncoprotein; Transcription factor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: Golgi membrane; nucleoplasm; endoplasmic reticulum membrane; cell surface; integral to membrane; extracellular region; acrosome; plasma membrane; cytosol; nucleus; receptor complex

Molecular Function: enzyme inhibitor activity; protein binding; enzyme binding; chromatin DNA binding; sequence-specific DNA binding; receptor activity; calcium ion binding; transcription factor activity

Biological Process: neural tube development; negative regulation of calcium ion-dependent exocytosis; positive regulation of apoptosis; heart development; positive regulation of transcription, DNA-dependent; positive regulation of JAK-STAT cascade; response to lipopolysaccharide; cell differentiation in spinal cord; response to corticosteroid stimulus; negative regulation of BMP signaling pathway; compartment specification; positive regulation of endothelial cell differentiation; negative regulation of ossification; oligodendrocyte differentiation; somatic stem cell division; negative regulation of osteoblast differentiation; positive regulation of astrocyte differentiation; positive regulation of cardiac muscle cell proliferation; positive regulation of keratinocyte differentiation; negative regulation of photoreceptor cell differentiation; positive regulation of neuroblast proliferation; organ regeneration; Notch receptor processing; keratinocyte differentiation; branching morphogenesis of a tube; response to muramyl dipeptide; positive regulation of transcription from RNA polymerase II promoter; determination of left/right symmetry; negative regulation of transcription, DNA-dependent; positive regulation of epithelial cell proliferation; foregut morphogenesis; endoderm development; cell fate specification; cardiac muscle cell proliferation; negative regulation of transcription from RNA polymerase II promoter; embryonic hindlimb morphogenesis; negative regulation of neurogenesis; negative regulation of cell proliferation; astrocyte differentiation; regulation of transcription, DNA-dependent; tissue regeneration; forebrain development; positive regulation of cell proliferation; cardiac muscle morphogensis; heart looping; regulation of somitogenesis; positive regulation of BMP signaling pathway; mesenchymal cell development; transcription initiation from RNA polymerase II promoter; Notch signaling pathway; hair follicle morphogenesis; in utero embryonic development; lumen formation; liver development; humoral immune response; activation of Notch receptor target transcription factor; negative regulation of oligodendrocyte differentiation; inflammatory response to antigenic stimulus; axonogenesis; negative regulation of catalytic activity; epithelial to mesenchymal transition; immune response; gene expression; spermatogenesis; sprouting angiogenesis; negative regulation of myoblast differentiation; auditory receptor cell fate commitment; lung development; positive regulation of cell migration

Disease: Adams-oliver Syndrome 5; Aortic Valve Disease 1

Research Articles on NOTCH1

Similar Products

Product Notes

The NOTCH1 notch1 (Catalog #AAA6148529) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NOTCH1 (Notch 1, Neurogenic Locus Notch Homolog Protein 1, hN1, Translocation-associated Notch Protein TAN-1, TAN1) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NOTCH1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOTCH1 notch1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOTCH1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.