Mouse anti-Human Mediterranean Fever Monoclonal Antibody | anti-MEF antibody

Mediterranean Fever (MEFV, Pyrin, Marenostrin, MEF) (FITC)

Cat. Num. AAA6148186

• Gene Names: MEFV; FMF; MEF; TRIM20
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Mediterranean Fever; Monoclonal Antibody; Mediterranean Fever (MEFV; Pyrin; Marenostrin; MEF) (FITC); anti-MEF antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4E6
• Specificity: Recognizes human MEFV.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-MEF antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-110 from human MEFV (NP_000234) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged MEFV is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-MEF antibody

MEFV was identified as the gene that when mutated causes Mediterranean fever, a hereditary periodic fever syndrome. MEFV is expressed in granulocytes and myeloid bone marrow precursors.

Product Categories/Family for anti-MEF antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4557743
• NCBI GeneID: 4210
• NCBI Accession #: NP_000234
• NCBI GenBank Nucleotide #: NM_000243
• UniProt Accession #: O15553; Q3MJ84; Q96PN4; Q96PN5; D3DUC0; F5H0Q3
• Molecular Weight: 50,837 Da
• NCBI Official Full Name: pyrin isoform 1
• NCBI Official Synonym Full Names: Mediterranean fever
• NCBI Official Symbol: MEFV
• NCBI Official Synonym Symbols: FMF; MEF; TRIM20
• NCBI Protein Information: pyrin; marenostrin
• UniProt Protein Name: Pyrin
• UniProt Gene Name: MEFV
• UniProt Entry Name: MEFV_HUMAN

Uniprot Description

pyrin: Probably controls the inflammatory response in myelomonocytic cells at the level of the cytoskeleton organization. Defects in MEFV are the cause of familial Mediterranean fever autosomal recessive (ARFMF). ARFMF is an inherited disorder characterized by recurrent episodic fever, serosal inflammation and pain in the abdomen, chest or joints. ARFMF is frequently complicated by amyloidosis, which leads to renal failure and can be prophylactically treated with colchicine. ARFMF primarily affects ancestral ethnic groups living around the Mediterranean basin: North African Jews, Armenians, Arabs and Turks. The disease is also distributed in other populations including Greeks, Cypriots, Italians and Spanish, although at a lower prevalence. Defects in MEFV are the cause of familial Mediterranean fever autosomal dominant (ADFMF). ADFMF is characterized by periodic fever, serosal inflammation and pain in the abdomen, chest or joints as seen also in the autosomal recessive form of the disease. It is associated with renal amyloidosis and characterized by colchicine unresponsiveness. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: autophagic vacuole; cytoplasm; cytoplasmic vesicle; cytosol; lamellipodium; microtubule; microtubule associated complex; nucleus; ruffle

Molecular Function: actin binding; protein binding; zinc ion binding

Biological Process: inflammatory response; negative regulation of inflammatory response; negative regulation of interleukin-1 beta production; negative regulation of interleukin-12 production; positive regulation of autophagy

Disease: Familial Mediterranean Fever; Familial Mediterranean Fever, Autosomal Dominant