Mouse anti-Human GSTA2 Monoclonal Antibody | anti-GSTA2 antibody

GSTA2 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC10525) (FITC)

Cat. Num. AAA6147487

• Gene Names: GSTA2; GST2; GTA2; GTH2; GSTA2-2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography
• Synonyms: GSTA2; Monoclonal Antibody; GSTA2 (Glutathione S-transferase A3; GST Class-alpha Member 3; Glutathione S-transferase A3-3; MGC10525) (FITC); anti-GSTA2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3D4
• Specificity: Recognizes human GSTA2.
• Purity/Purification: Purified by Protein A Affinity Chromatography
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-GSTA2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human GSTA2 (AAH02895) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(GSTA2 monoclonal antibody. Western Blot analysis of GSTA2 expression in human liver.)

Western Blot (WB)

(GSTA2 monoclonal antibody. Western Blot analysis of GSTA2 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged GSTA2 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-GSTA2 antibody

Antibodies; Epitope Tag; GST

NCBI and Uniprot Product Information

• NCBI GI #: 33877307
• NCBI GeneID: 2939
• Molecular Weight: 25,664 Da
• NCBI Official Full Name: Homo sapiens glutathione S-transferase alpha 2, mRNA
• NCBI Official Synonym Full Names: glutathione S-transferase alpha 2
• NCBI Official Symbol: GSTA2
• NCBI Official Synonym Symbols: GST2; GTA2; GTH2; GSTA2-2
• NCBI Protein Information: glutathione S-transferase A2
• Protein Family: Glutathione S-transferase

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq, Jul 2008]