Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human DTX3L Monoclonal Antibody | anti-DTX3L antibody

DTX3L (E3 Ubiquitin-protein Ligase DTX3L, B-lymphoma- and BAL-associated Protein, Protein Deltex-3-like, Rhysin-2, Rhysin2, BBAP) (FITC)

Gene Names
DTX3L; BBAP
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DTX3L; Monoclonal Antibody; DTX3L (E3 Ubiquitin-protein Ligase DTX3L; B-lymphoma- and BAL-associated Protein; Protein Deltex-3-like; Rhysin-2; Rhysin2; BBAP) (FITC); anti-DTX3L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D10
Specificity
Recognizes human DTX3L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-DTX3L antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 6ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa3-111 from human DTX3L (NP_612144) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(DTX3L monoclonal antibody, Western Blot analysis of DTX3L expression in A-431.)

Western Blot (WB) (DTX3L monoclonal antibody, Western Blot analysis of DTX3L expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DTX3L on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 6ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to DTX3L on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 6ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DTX3L is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DTX3L is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-DTX3L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,792 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase DTX3L
NCBI Official Synonym Full Names
deltex 3 like, E3 ubiquitin ligase
NCBI Official Symbol
DTX3L
NCBI Official Synonym Symbols
BBAP
NCBI Protein Information
E3 ubiquitin-protein ligase DTX3L; B-lymphoma- and BAL-associated protein; deltex 3-like; rhysin 2; rhysin-2; rhysin2
UniProt Protein Name
E3 ubiquitin-protein ligase DTX3L
UniProt Gene Name
DTX3L
UniProt Synonym Gene Names
BBAP; Rhysin2
UniProt Entry Name
DTX3L_HUMAN

Similar Products

Product Notes

The DTX3L dtx3l (Catalog #AAA6146923) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DTX3L (E3 Ubiquitin-protein Ligase DTX3L, B-lymphoma- and BAL-associated Protein, Protein Deltex-3-like, Rhysin-2, Rhysin2, BBAP) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DTX3L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 6ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DTX3L dtx3l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DTX3L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.