Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human DHODH Monoclonal Antibody | anti-DHODH antibody

DHODH (Dihydroorotate Dehydrogenase (Quinone), Mitochondrial, DHOdehase, Dihydroorotate Oxidase) (FITC)

Gene Names
DHODH; URA1; POADS; DHOdehase
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DHODH; Monoclonal Antibody; DHODH (Dihydroorotate Dehydrogenase (Quinone); Mitochondrial; DHOdehase; Dihydroorotate Oxidase) (FITC); anti-DHODH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
6E1
Specificity
Recognizes human DHODH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-DHODH antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa32-140 from human DHODH (NP_001352) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQ
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(DHODH monoclonal antibody Western Blot analysis of DHODH expression in MCF-7.)

Western Blot (WB) (DHODH monoclonal antibody Western Blot analysis of DHODH expression in MCF-7.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DHODH on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to DHODH on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged DHODH is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DHODH is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-DHODH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42.3 kDa (390aa) confirmed by MALDI-TOF
NCBI Official Full Name
dihydroorotate dehydrogenase (quinone), mitochondrial
NCBI Official Synonym Full Names
dihydroorotate dehydrogenase (quinone)
NCBI Official Symbol
DHODH
NCBI Official Synonym Symbols
URA1; POADS; DHOdehase
NCBI Protein Information
dihydroorotate dehydrogenase (quinone), mitochondrial
UniProt Protein Name
Dihydroorotate dehydrogenase (quinone), mitochondrial
UniProt Gene Name
DHODH
UniProt Synonym Gene Names
DHOdehase
UniProt Entry Name
PYRD_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. [provided by RefSeq, Jul 2008]

Uniprot Description

DHODH: Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor. Defects in DHODH are the cause of postaxial acrofacial dysostosis (POADS); also known as Miller syndrome. POADS is characterized by severe micrognathia, cleft lip and/or palate, hypoplasia or aplasia of the posterior elements of the limbs, coloboma of the eyelids and supernumerary nipples. POADS is a very rare disorder: only 2 multiplex families, each consisting of 2 affected siblings born to unaffected, nonconsanguineous parents, have been described among a total of around 30 reported cases. Belongs to the dihydroorotate dehydrogenase family. Type 2 subfamily.

Protein type: Mitochondrial; EC 1.3.5.2; Nucleotide Metabolism - pyrimidine; Oxidoreductase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16q22

Cellular Component: nucleoplasm; mitochondrion; cell soma; mitochondrial inner membrane; integral to membrane; intrinsic to mitochondrial inner membrane

Molecular Function: ubiquinone binding; FMN binding; dihydroorotate dehydrogenase activity; drug binding

Biological Process: lactation; response to starvation; response to drug; 'de novo' pyrimidine base biosynthetic process; pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; positive regulation of apoptosis; pyrimidine nucleoside biosynthetic process; female pregnancy; response to caffeine

Disease: Postaxial Acrofacial Dysostosis

Research Articles on DHODH

Similar Products

Product Notes

The DHODH dhodh (Catalog #AAA6146837) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DHODH (Dihydroorotate Dehydrogenase (Quinone), Mitochondrial, DHOdehase, Dihydroorotate Oxidase) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHODH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DHODH dhodh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DHODH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.