Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen using 124403 (37.11kD).)

Mouse anti-Human CBX2 Monoclonal Antibody | anti-CBX2 antibody

CBX2 (Chromobox Protein Homolog 2, CDCA6, M33, MGC10561) (FITC)

Gene Names
CBX2; M33; CDCA6; SRXY5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CBX2; Monoclonal Antibody; CBX2 (Chromobox Protein Homolog 2; CDCA6; M33; MGC10561) (FITC); anti-CBX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E2
Specificity
Recognizes human CBX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CBX2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa66-165 from human CBX2 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen using 124403 (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen using 124403 (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged CBX2 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CBX2 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-CBX2 antibody
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Involved in sexual development, acting as activator of NR5A1 expression.
Product Categories/Family for anti-CBX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,312 Da
NCBI Official Full Name
chromobox protein homolog 2 isoform 2
NCBI Official Synonym Full Names
chromobox homolog 2
NCBI Official Symbol
CBX2
NCBI Official Synonym Symbols
M33; CDCA6; SRXY5
NCBI Protein Information
chromobox protein homolog 2; Pc class homolog; cell division cycle associated 6; chromobox homolog 2 (Pc class homolog, Drosophila); modifier 3
UniProt Protein Name
Chromobox protein homolog 2
Protein Family
UniProt Gene Name
CBX2
UniProt Entry Name
CBX2_HUMAN

Similar Products

Product Notes

The CBX2 cbx2 (Catalog #AAA6146295) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CBX2 (Chromobox Protein Homolog 2, CDCA6, M33, MGC10561) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CBX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CBX2 cbx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CBX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.