Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human CBX1 Monoclonal Antibody | anti-CBX1 antibody

CBX1 (CBX, Chromobox Protein Homolog 1, HP1Hsbeta, Heterochromatin Protein 1 Homolog beta, Heterochromatin Protein p25, M31, Modifier 1 Protein, p25beta) (FITC)

Gene Names
CBX1; CBX; M31; MOD1; p25beta; HP1-BETA; HP1Hsbeta; HP1Hs-beta
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CBX1; Monoclonal Antibody; CBX1 (CBX; Chromobox Protein Homolog 1; HP1Hsbeta; Heterochromatin Protein 1 Homolog beta; Heterochromatin Protein p25; M31; Modifier 1 Protein; p25beta) (FITC); anti-CBX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E12
Specificity
Recognizes human CBX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CBX1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa2-99 from human CBX1 (NM_006807, NP_006798.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(Western Blot analysis of CBX1 expression in transfected 293T cell line using 124402. Lane 1: CBX1 transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CBX1 expression in transfected 293T cell line using 124402. Lane 1: CBX1 transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CBX1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CBX1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-CBX1 antibody
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq].
Product Categories/Family for anti-CBX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,418 Da
NCBI Official Full Name
chromobox protein homolog 1
NCBI Official Synonym Full Names
chromobox homolog 1
NCBI Official Symbol
CBX1
NCBI Official Synonym Symbols
CBX; M31; MOD1; p25beta; HP1-BETA; HP1Hsbeta; HP1Hs-beta
NCBI Protein Information
chromobox protein homolog 1; HP1 beta homolog; modifier 1 protein; heterochromatin protein 1-beta; heterochromatin protein p25 beta; heterochromatin protein 1 homolog beta; chromobox homolog 1 (HP1 beta homolog Drosophila )
UniProt Protein Name
Chromobox protein homolog 1
Protein Family
UniProt Gene Name
CBX1
UniProt Synonym Gene Names
CBX; HP1 beta
UniProt Entry Name
CBX1_HUMAN

NCBI Description

This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

CBX1: Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane. Homodimer. Interacts directly with CHAF1A, EMSY, LBR, TIF1/TIF1A and TRIM28/TIF1B PXVXL motif via the chromoshadow domain. Interacts directly with histone H3 methylated at 'Lys-9' via the chromo domain. Interacts with SUV39H1 and SETDB1, SUV420H1 and SUV420H2. Interacts with PRDM6. Interacts with POGZ. Interacts with CHAMP1. Interacts with ASXL1. Expressed in all adult and embryonic tissues.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: nucleoplasm; centric heterochromatin; male pronucleus; female pronucleus; spindle; nuclear heterochromatin; chromatin; chromosome, pericentric region; chromocenter

Molecular Function: protein binding; protein homodimerization activity; enzyme binding; chromatin binding

Biological Process: negative regulation of transcription, DNA-dependent

Research Articles on CBX1

Similar Products

Product Notes

The CBX1 cbx1 (Catalog #AAA6146294) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CBX1 (CBX, Chromobox Protein Homolog 1, HP1Hsbeta, Heterochromatin Protein 1 Homolog beta, Heterochromatin Protein p25, M31, Modifier 1 Protein, p25beta) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CBX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CBX1 cbx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CBX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.