Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human ATP1B2 Monoclonal Antibody | anti-ATP1B2 antibody

ATP1B2 (Sodium/Potassium-transporting ATPase Subunit beta-2, Sodium/Potassium-dependent ATPase Subunit beta-2) (FITC)

Gene Names
ATP1B2; AMOG
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP1B2; Monoclonal Antibody; ATP1B2 (Sodium/Potassium-transporting ATPase Subunit beta-2; Sodium/Potassium-dependent ATPase Subunit beta-2) (FITC); anti-ATP1B2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E3
Specificity
Recognizes human ATP1B2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ATP1B2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa84-193 from human ATP1B2 (NP_001669.3) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGAN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged ATP1B2 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ATP1B2 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-ATP1B2 antibody
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-2 subunit is not known.
Product Categories/Family for anti-ATP1B2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
482
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,367 Da
NCBI Official Full Name
sodium/potassium-transporting ATPase subunit beta-2 isoform 1
NCBI Official Synonym Full Names
ATPase, Na+/K+ transporting, beta 2 polypeptide
NCBI Official Symbol
ATP1B2
NCBI Official Synonym Symbols
AMOG
NCBI Protein Information
sodium/potassium-transporting ATPase subunit beta-2; Na, K-ATPase beta-2 polypeptide; adhesion molecule in glia; adhesion molecule on glia; sodium pump subunit beta-2; sodium-potassium ATPase subunit beta 2 (non-catalytic); sodium/potassium-dependent ATPa
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit beta-2
UniProt Gene Name
ATP1B2
UniProt Synonym Gene Names
AMOG
UniProt Entry Name
AT1B2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]

Uniprot Description

ATP1B2: This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-2 subunit is not known. Belongs to the X(+)/potassium ATPases subunit beta family.

Protein type: Cell adhesion; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: apical plasma membrane; cytoplasm; plasma membrane; sodium:potassium-exchanging ATPase complex

Molecular Function: ATPase activator activity; protein binding; sodium:potassium-exchanging ATPase activity; ATPase binding

Biological Process: cellular sodium ion homeostasis; protein stabilization; potassium ion import; transport; positive regulation of ATPase activity; blood coagulation; cell adhesion; leukocyte migration; cellular potassium ion homeostasis; transmembrane transport

Research Articles on ATP1B2

Similar Products

Product Notes

The ATP1B2 atp1b2 (Catalog #AAA6146032) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP1B2 (Sodium/Potassium-transporting ATPase Subunit beta-2, Sodium/Potassium-dependent ATPase Subunit beta-2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP1B2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP1B2 atp1b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP1B2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.