Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human UBE2J1 Monoclonal Antibody | anti-UBE2J1 antibody

UBE2J1 (Ubiquitin-conjugating Enzyme E2 J1, CGI-76, HSPC153, HSPC205, Non-canonical Ubiquitin-conjugating Enzyme 1, NCUBE1, NCUBE-1, Yeast Ubiquitin-conjugating Enzyme UBC6 Homolog E, HsUBC6e) (Biotin)

Gene Names
UBE2D1; SFT; UBCH5; UBC4/5; UBCH5A; E2(17)KB1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE2J1; Monoclonal Antibody; UBE2J1 (Ubiquitin-conjugating Enzyme E2 J1; CGI-76; HSPC153; HSPC205; Non-canonical Ubiquitin-conjugating Enzyme 1; NCUBE1; NCUBE-1; Yeast Ubiquitin-conjugating Enzyme UBC6 Homolog E; HsUBC6e) (Biotin); EC=6.3.2.19; UBC6; Ubc6p; HSU93243; anti-UBE2J1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6A12
Specificity
Recognizes human UBE2J1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-UBE2J1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 0.1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa9-119 from human UBE2J1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGF
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(UBE2J1 monoclonal antibody, Western Blot analysis of UBE2J1 expression in HeLa.)

Western Blot (WB) (UBE2J1 monoclonal antibody, Western Blot analysis of UBE2J1 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged UBE2J1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBE2J1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE2J1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.0 kDa (170aa), confirmed by MALDI-TOF
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 D1 isoform 1
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 D1
NCBI Official Symbol
UBE2D1
NCBI Official Synonym Symbols
SFT; UBCH5; UBC4/5; UBCH5A; E2(17)KB1
NCBI Protein Information
ubiquitin-conjugating enzyme E2 D1
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 D1
UniProt Gene Name
UBE2D1
UniProt Synonym Gene Names
SFT; UBC5A; UBCH5; UBCH5A; SFT
UniProt Entry Name
UB2D1_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

UBE2D1: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP- induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6 and TRIM63/MURF1. Ubiquitinates STUB1-associated HSP90AB1 in vitro. Lacks inherent specificity for any particular lysine residue of ubiquitin. Essential for viral activation of IRF3. Mediates polyubiquitination of CYP3A4. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: Ubiquitin conjugating system; EC 6.3.2.19; Ubiquitin ligase; Ligase

Chromosomal Location of Human Ortholog: 10q21.1

Cellular Component: nucleoplasm; protein complex; cytoplasm; cytosol; ubiquitin ligase complex

Molecular Function: protein binding; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; ubiquitin-dependent protein catabolic process; transcription initiation from RNA polymerase II promoter; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; transcription, DNA-dependent; MyD88-independent toll-like receptor signaling pathway; toll-like receptor 3 signaling pathway; negative regulation of transcription from RNA polymerase II promoter; BMP signaling pathway; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein ubiquitination; transforming growth factor beta receptor signaling pathway; mitotic cell cycle spindle assembly checkpoint; toll-like receptor signaling pathway; innate immune response; gene expression; mitotic cell cycle; toll-like receptor 4 signaling pathway

Research Articles on UBE2J1

Similar Products

Product Notes

The UBE2J1 ube2d1 (Catalog #AAA6145026) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2J1 (Ubiquitin-conjugating Enzyme E2 J1, CGI-76, HSPC153, HSPC205, Non-canonical Ubiquitin-conjugating Enzyme 1, NCUBE1, NCUBE-1, Yeast Ubiquitin-conjugating Enzyme UBC6 Homolog E, HsUBC6e) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2J1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 0.1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2J1 ube2d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2J1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.