Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human UBE2J1 Monoclonal Antibody | anti-UBE2J1 antibody

UBE2J1 (Ubiquitin-conjugating Enzyme E2 J1, CGI-76, HSPC153, HSPC205, Non-canonical Ubiquitin-conjugating Enzyme 1, NCUBE1, NCUBE-1, Yeast Ubiquitin-conjugating Enzyme UBC6 Homolog E, HsUBC6e)

Gene Names
UBE2J1; UBC6; Ubc6p; CGI-76; NCUBE1; HSPC153; HSPC205; NCUBE-1; HSU93243
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
UBE2J1; Monoclonal Antibody; UBE2J1 (Ubiquitin-conjugating Enzyme E2 J1; CGI-76; HSPC153; HSPC205; Non-canonical Ubiquitin-conjugating Enzyme 1; NCUBE1; NCUBE-1; Yeast Ubiquitin-conjugating Enzyme UBC6 Homolog E; HsUBC6e); Anti -UBE2J1 (Ubiquitin-conjugating Enzyme E2 J1; anti-UBE2J1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6A12
Specificity
Recognizes human UBE2J1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGF
Applicable Applications for anti-UBE2J1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Dilution: ELISA: 0.1ng/ml
Immunogen
Partial recombinant corresponding to aa9-119 from human UBE2J1 with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(UBE2J1 monoclonal antibody, Western Blot analysis of UBE2J1 expression in HeLa.)

Western Blot (WB) (UBE2J1 monoclonal antibody, Western Blot analysis of UBE2J1 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged UBE2J1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBE2J1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE2J1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,199 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 J1
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2, J1
NCBI Official Symbol
UBE2J1
NCBI Official Synonym Symbols
UBC6; Ubc6p; CGI-76; NCUBE1; HSPC153; HSPC205; NCUBE-1; HSU93243
NCBI Protein Information
ubiquitin-conjugating enzyme E2 J1; HSUBC6e; ubiquitin-conjugating enzyme E2, J1, U; non-canonical ubiquitin-conjugating enzyme 1; yeast ubiquitin-conjugating enzyme UBC6 homolog E; ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 J1
UniProt Gene Name
UBE2J1
UniProt Synonym Gene Names
NCUBE1; NCUBE-1; HsUBC6e
UniProt Entry Name
UB2J1_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD). Ref.2 Ref.15

Catalytic activity: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine.

Pathway: Protein modification; protein ubiquitination.

Subcellular location: Endoplasmic reticulum membrane; Single-pass type IV membrane protein Ref.2.

Sequence similarities: Belongs to the ubiquitin-conjugating enzyme family.

Sequence caution: The sequence AAD34071.1 differs from that shown. Reason: Erroneous initiation. The sequence AAF36125.1 differs from that shown. Reason: Frameshift at position 119.

Research Articles on UBE2J1

Similar Products

Product Notes

The UBE2J1 ube2j1 (Catalog #AAA647785) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2J1 (Ubiquitin-conjugating Enzyme E2 J1, CGI-76, HSPC153, HSPC205, Non-canonical Ubiquitin-conjugating Enzyme 1, NCUBE1, NCUBE-1, Yeast Ubiquitin-conjugating Enzyme UBC6 Homolog E, HsUBC6e) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2J1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Dilution: ELISA: 0.1ng/ml. Researchers should empirically determine the suitability of the UBE2J1 ube2j1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SPAVKRLMKE AAELKDPTDH YHAQPLEDNL FEWHFTVRGP PDSDFDGGVY HGRIVLPPEY PMKPPSIILL TANGRFEVGK KICLSISGHH PETWQPSWSI RTALLAIIGF. It is sometimes possible for the material contained within the vial of "UBE2J1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.