Mouse anti-Human, Rat TSSC1 Monoclonal Antibody | anti-TSSC1 antibody

TSSC1 (Tumor-suppressing Subchromosomal Transferable Fragment Candidate Gene 1 Protein, Tumor-suppressing STF cDNA 1 Protein, Protein TSSC1) (Biotin)

Cat. Num. AAA6144964

• Gene Names: EIPR1; TSSC1; EIPR-1
• Reactivity: Human, Rat
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TSSC1; Monoclonal Antibody; TSSC1 (Tumor-suppressing Subchromosomal Transferable Fragment Candidate Gene 1 Protein; Tumor-suppressing STF cDNA 1 Protein; Protein TSSC1) (Biotin); anti-TSSC1 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H5
• Specificity: Recognizes human TSSC1. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1657

• Applicable Applications for anti-TSSC1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa288-387 from human TSSC1 (NP_003301) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VLTGSSDSRVILSNMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSVYAVDWSSADPWLFASLSYDGRLVINRVPRALKYHILL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(TSSC1 monoclonal antibody. Western Blot analysis of TSSC1 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of TSSC1 expression in transfected 293T cell line by TSSC1 monoclonal antibody. Lane 1: TSSC1 transfected lysate (Predicted MW: 43.6kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TSSC1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TSSC1 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-TSSC1 antibody

Antibodies; Tumor Suppressors

NCBI and Uniprot Product Information

• NCBI GI #: 1813794416
• NCBI GeneID: 7260
• NCBI Accession #: NM_003310.5
• NCBI GenBank Nucleotide #: NM_003310
• UniProt Accession #: Q53HC9
• NCBI Official Full Name: Homo sapiens EARP complex and GARP complex interacting protein 1 (EIPR1), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: EARP complex and GARP complex interacting protein 1
• NCBI Official Symbol: EIPR1
• NCBI Official Synonym Symbols: TSSC1; EIPR-1
• NCBI Protein Information: EARP and GARP complex-interacting protein 1
• UniProt Protein Name: Protein TSSC1
• Protein Family: Protein
• UniProt Gene Name: TSSC1
• UniProt Entry Name: TSSC1_HUMAN

NCBI Description

This gene has been reported in PMID 9403053 as one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alignment of this gene to genomic sequence data suggests that this gene resides on chromosome 2 rather than chromosome 11. [provided by RefSeq, Dec 2008]

Uniprot Description

TSSC1:

Chromosomal Location of Human Ortholog: 2p25.3