Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TIMP1 expression in transfected 293T cell line by TIMP1 monoclonal antibody. Lane 1: TIMP1 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human TIMP1 Monoclonal Antibody | anti-TIMP1 antibody

TIMP1 (Tissue Inhibitor of Metalloproteinases 1, TIMP-1, TIMP, Metalloproteinase Inhibitor 1, Collagenase inhibitor, CLGI, Erythroid-potentiating Activity, EPA, Fibroblast Collagenase Inhibitor) (Biotin)

Gene Names
TIMP1; EPA; EPO; HCI; CLGI; TIMP; TIMP-1
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TIMP1; Monoclonal Antibody; TIMP1 (Tissue Inhibitor of Metalloproteinases 1; TIMP-1; TIMP; Metalloproteinase Inhibitor 1; Collagenase inhibitor; CLGI; Erythroid-potentiating Activity; EPA; Fibroblast Collagenase Inhibitor) (Biotin); EPO; HCI; anti-TIMP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D12
Specificity
Recognizes human TIMP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TIMP1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-170 from human TIMP1 (AAH07097) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TIMP1 expression in transfected 293T cell line by TIMP1 monoclonal antibody. Lane 1: TIMP1 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TIMP1 expression in transfected 293T cell line by TIMP1 monoclonal antibody. Lane 1: TIMP1 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of TIMP1 transfected lysate using TIMP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TIMP1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of TIMP1 transfected lysate using TIMP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TIMP1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged TIMP1 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TIMP1 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-TIMP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
23,171 Da
NCBI Official Full Name
Homo sapiens TIMP metallopeptidase inhibitor 1, mRNA
NCBI Official Synonym Full Names
TIMP metallopeptidase inhibitor 1
NCBI Official Symbol
TIMP1
NCBI Official Synonym Symbols
EPA; EPO; HCI; CLGI; TIMP; TIMP-1
NCBI Protein Information
metalloproteinase inhibitor 1

NCBI Description

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction. [provided by RefSeq, Jul 2008]

Research Articles on TIMP1

Similar Products

Product Notes

The TIMP1 (Catalog #AAA6144813) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TIMP1 (Tissue Inhibitor of Metalloproteinases 1, TIMP-1, TIMP, Metalloproteinase Inhibitor 1, Collagenase inhibitor, CLGI, Erythroid-potentiating Activity, EPA, Fibroblast Collagenase Inhibitor) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TIMP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TIMP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TIMP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.