Rabbit anti-Human TIMP1 Polyclonal Antibody | anti-TIMP1 antibody

TIMP1 (Tissue Inhibitor of Metalloproteinases 1, TIMP-1, TIMP, Metalloproteinase Inhibitor 1, Collagenase inhibitor, CLGI, Erythroid-potentiating Activity, EPA, Fibroblast Collagenase Inhibitor) (AP)

Cat. Num. AAA6396555

• Gene Names: TIMP1; EPA; EPO; HCI; CLGI; TIMP
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TIMP1; Polyclonal Antibody; TIMP1 (Tissue Inhibitor of Metalloproteinases 1; TIMP-1; TIMP; Metalloproteinase Inhibitor 1; Collagenase inhibitor; CLGI; Erythroid-potentiating Activity; EPA; Fibroblast Collagenase Inhibitor) (AP); EPO; HCI; anti-TIMP1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TIMP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-TIMP1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human TIMP1, aa1-207 (AAH00866.1).
• Immunogen Sequence: MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TIMP1 expression in transfected 293T cell line by TIMP1 polyclonal antibody. Lane 1: TIMP1 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-TIMP1 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 12654107
• NCBI GeneID: 7076
• NCBI Accession #: AAH00866.1
• NCBI GenBank Nucleotide #: NM_003254
• Molecular Weight: 23,171 Da
• NCBI Official Full Name: TIMP metallopeptidase inhibitor 1
• NCBI Official Synonym Full Names: TIMP metallopeptidase inhibitor 1
• NCBI Official Symbol: TIMP1
• NCBI Official Synonym Symbols: EPA; EPO; HCI; CLGI; TIMP
• NCBI Protein Information: metalloproteinase inhibitor 1; TIMP-1; collagenase inhibitor; erythroid potentiating activity; erythroid-potentiating activity; fibroblast collagenase inhibitor; tissue inhibitor of metalloproteinases 1
• Protein Family: Metalloproteinase inhibitor

NCBI Description

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction. [provided by RefSeq, Jul 2008]