Testing Data
(Detection limit for recombinant GST tagged STRN3 is 0.3ng/ml as a capture antibody.)
Mouse anti-Human Striatin-3 Monoclonal Antibody | anti-STRN3 antibody
Striatin-3 (STRN3, Cell Cycle Autoantigen SG2NA GS2NA, S/G2 Antigen, SG2NA) (Biotin)
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Striatin-3; Monoclonal Antibody; Striatin-3 (STRN3; Cell Cycle Autoantigen SG2NA GS2NA; S/G2 Antigen; SG2NA) (Biotin); anti-STRN3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A5
Specificity
Recognizes human STRN3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
713
Applicable Applications for anti-STRN3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa614-713 from human STRN3 (NP_055389) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged STRN3 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged STRN3 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-STRN3 antibody
SG2NA, also known as Striatin 3, was identified as a human cancer auto-antigen and has not been implicated in vesicular trafficking and signal tranduction. It is highly related to striatin and zinedin (striatin 4). It is a cytoplasmic scaffolding protein that binds to Calmodulin and PP2A A and C subunits as well as the human homolog of the yeast protein, Mob1, which appears to modulate PP2A activity.
Product Categories/Family for anti-STRN3 antibody
NCBI and Uniprot Product Information
Uniprot Description
Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.CautionWas originally thought to be nuclear.
Similar Products
Product Notes
The STRN3 strn3 (Catalog #AAA6144651) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Striatin-3 (STRN3, Cell Cycle Autoantigen SG2NA GS2NA, S/G2 Antigen, SG2NA) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Striatin-3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STRN3 strn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Striatin-3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
