Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SRP68 Monoclonal Antibody | anti-SRP68 antibody

SRP68 (Signal Recognition Particle 68kD Protein) (Biotin)

Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SRP68; Monoclonal Antibody; SRP68 (Signal Recognition Particle 68kD Protein) (Biotin); anti-SRP68 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A3
Specificity
Recognizes human SRP68.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SRP68 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa531-628 from human SRP68 (NP_055045) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRS*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(SRP68 monoclonal antibody. Western Blot analysis of SRP68 expression in HeLa.)

Western Blot (WB) (SRP68 monoclonal antibody. Western Blot analysis of SRP68 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SRP68 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SRP68 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SRP68 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SRP68 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-SRP68 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,108 Da
NCBI Official Full Name
signal recognition particle subunit SRP68 isoform 1
NCBI Official Synonym Full Names
signal recognition particle 68
NCBI Official Symbol
SRP68
NCBI Protein Information
signal recognition particle subunit SRP68
UniProt Protein Name
Signal recognition particle subunit SRP68
UniProt Gene Name
SRP68
UniProt Synonym Gene Names
SRP68
UniProt Entry Name
SRP68_HUMAN

NCBI Description

This gene encodes a subunit of the signal recognition particle (SRP). The SRP is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. The encoded protein is the 68kDa component of the SRP, and forms a heterodimer with the 72kDa subunit that is required for SRP function. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and three pseudogenes of this gene are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, May 2012]

Uniprot Description

SRP68: Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP68 binds the 7S RNA, SRP72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function. Belongs to the SRP68 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum; Nucleolus; RNA-binding

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: focal adhesion; endoplasmic reticulum; cytoplasm; nucleolus; signal recognition particle, endoplasmic reticulum targeting; ribosome; cytosol

Molecular Function: signal recognition particle binding; signal sequence binding; endoplasmic reticulum signal peptide binding; 7S RNA binding

Biological Process: response to drug; protein targeting to ER; SRP-dependent cotranslational protein targeting to membrane; cellular protein metabolic process; translation; gene expression

Research Articles on SRP68

Similar Products

Product Notes

The SRP68 srp68 (Catalog #AAA6144586) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SRP68 (Signal Recognition Particle 68kD Protein) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SRP68 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SRP68 srp68 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SRP68, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.