Mouse anti-Human, Mouse SP1 Monoclonal Antibody | anti-SP1 antibody

SP1 (Transcription Factor Sp1, TSFP1) (Biotin)

Cat. Num. AAA6144544

• Reactivity: Human, Mouse
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SP1; Monoclonal Antibody; SP1 (Transcription Factor Sp1; TSFP1) (Biotin); anti-SP1 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone Number: 1A5
• Specificity: Recognizes human SP1. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SP1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa89-199 from human SP1 (NP_612482) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(SP1 monoclonal antibody, Western Blot analysis of SP1 expression in Hela NE.)

Western Blot (WB)

(SP1 monoclonal antibody. Western Blot analysis of SP1 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SP1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SP1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SP1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 38372901
• NCBI GeneID: 6667
• NCBI Accession #: NP_612482
• NCBI GenBank Nucleotide #: NM_138473
• UniProt Accession #: P08047; Q86TN8; Q9H3Q5; Q9NR51; Q9NY21; Q9NYE7; E4Z9M7; G5E9M8
• Molecular Weight: 75,824 Da
• NCBI Official Full Name: transcription factor Sp1 isoform a
• NCBI Official Synonym Full Names: Sp1 transcription factor
• NCBI Official Symbol: SP1
• NCBI Protein Information: transcription factor Sp1
• UniProt Protein Name: Transcription factor Sp1
• Protein Family: Sp110 nuclear body protein
• UniProt Gene Name: SP1
• UniProt Synonym Gene Names: TSFP1
• UniProt Entry Name: SP1_HUMAN

NCBI Description

The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]

Uniprot Description

SP1: a transcription factor of the Sp1 C2H2-type zinc-finger protein family. Phosphorylated and activated by MAPK. Dephosphorylation by PTEN inhibits DNA binding. Binds to p38 in the nucleus. Interacts with Huntingtin and TAFII130. Transcriptional activity of SP1 and TAFII130 disrupted in early Huntingtin's Disease.

Protein type: DNA-binding; Transcription factor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 12q13.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein C-terminus binding; histone acetyltransferase binding; protein binding; protein homodimerization activity; DNA binding; sequence-specific DNA binding; metal ion binding; histone deacetylase binding; double-stranded DNA binding; bHLH transcription factor binding; transcription factor binding; transcription factor activity

Biological Process: transcription initiation from RNA polymerase II promoter; ossification; embryonic placenta development; transcription, DNA-dependent; viral reproduction; megakaryocyte differentiation; embryonic skeletal development; positive regulation of transcription, DNA-dependent; embryonic process involved in female pregnancy; rhythmic process; cellular lipid metabolic process; enucleate erythrocyte differentiation; liver development; trophectodermal cell differentiation; regulation of transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; gene expression; positive regulation of transcription from RNA polymerase II promoter; embryonic camera-type eye morphogenesis; lung development