Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RARA monoclonal antibody, Western Blot analysis of RARA expression in A-431.)

Mouse anti-Human RARA Monoclonal Antibody | anti-RARA antibody

RARA (Retinoic Acid Receptor alpha, RAR-alpha, Nuclear Receptor Subfamily 1 Group B Member 1, NR1B1) (Biotin)

Gene Names
RARA; RAR; NR1B1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RARA; Monoclonal Antibody; RARA (Retinoic Acid Receptor alpha; RAR-alpha; Nuclear Receptor Subfamily 1 Group B Member 1; NR1B1) (Biotin); anti-RARA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C9-1F8
Specificity
Recognizes human RARA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RARA antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human RARA, aa1-463 (AAH08727) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RARA monoclonal antibody, Western Blot analysis of RARA expression in A-431.)

Western Blot (WB) (RARA monoclonal antibody, Western Blot analysis of RARA expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RARA on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RARA on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RARA on A-431 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RARA on A-431 cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-RARA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
39,700 Da
NCBI Official Full Name
Homo sapiens retinoic acid receptor, alpha, mRNA
NCBI Official Synonym Full Names
retinoic acid receptor alpha
NCBI Official Symbol
RARA
NCBI Official Synonym Symbols
RAR; NR1B1
NCBI Protein Information
retinoic acid receptor alpha
Protein Family

NCBI Description

This gene represents a nuclear retinoic acid receptor. The encoded protein, retinoic acid receptor alpha, regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulopoeisis, and transcription of clock genes. Translocations between this locus and several other loci have been associated with acute promyelocytic leukemia. Alternatively spliced transcript variants have been found for this locus.[provided by RefSeq, Sep 2010]

Research Articles on RARA

Similar Products

Product Notes

The RARA (Catalog #AAA6143926) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RARA (Retinoic Acid Receptor alpha, RAR-alpha, Nuclear Receptor Subfamily 1 Group B Member 1, NR1B1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RARA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RARA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RARA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.