Mouse anti-Human POLD3 Monoclonal Antibody | anti-POLD3 antibody

POLD3 (KIAA0039, DNA Polymerase delta Subunit 3, DNA Polymerase delta Subunit p66, MGC119642, MGC119643) (Biotin)

Cat. Num. AAA6143645

• Gene Names: POLD3; P66; P68; PPP1R128
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POLD3; Monoclonal Antibody; POLD3 (KIAA0039; DNA Polymerase delta Subunit 3; DNA Polymerase delta Subunit p66; MGC119642; MGC119643) (Biotin); anti-POLD3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E2
• Specificity: Recognizes human POLD3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-POLD3 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa357-466 from human POLD3 (NP_006582) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to POLD3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged POLD3 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-POLD3 antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 38492356
• NCBI GeneID: 10714
• NCBI Accession #: NP_006582
• NCBI GenBank Nucleotide #: NM_006591
• UniProt Accession #: Q15054
• Molecular Weight: 51kDa
• NCBI Official Full Name: DNA polymerase delta subunit 3 isoform 1
• NCBI Official Synonym Full Names: DNA polymerase delta 3, accessory subunit
• NCBI Official Symbol: POLD3
• NCBI Official Synonym Symbols: P66; P68; PPP1R128
• NCBI Protein Information: DNA polymerase delta subunit 3
• UniProt Protein Name: DNA polymerase delta subunit 3
• UniProt Gene Name: POLD3
• UniProt Synonym Gene Names: KIAA0039
• UniProt Entry Name: DPOD3_HUMAN

NCBI Description

This gene encodes the 66-kDa subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein plays a role in regulating the activity of DNA polymerase delta through interactions with other subunits and the processivity cofactor proliferating cell nuclear antigen (PCNA). Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

POLD3: Required for optimal DNA polymerase delta activity.

Protein type: Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine; DNA replication

Chromosomal Location of Human Ortholog: 11q14

Cellular Component: nucleoplasm; delta DNA polymerase complex; mitochondrion; nucleus

Molecular Function: protein binding; DNA-directed DNA polymerase activity

Biological Process: telomere maintenance via semi-conservative replication; DNA synthesis during DNA repair; mismatch repair; base-excision repair; nucleotide-excision repair; transcription-coupled nucleotide-excision repair; telomere maintenance via recombination; mitotic cell cycle; nucleotide-excision repair, DNA gap filling; DNA strand elongation during DNA replication; DNA repair; telomere maintenance