Mouse anti-Human PADI4 Monoclonal Antibody | anti-PADI4 antibody

PADI4 (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI5, PDI5) (Biotin)

Cat. Num. AAA6143342

• Gene Names: PADI4; PAD; PAD4; PDI4; PDI5; PADI5
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PADI4; Monoclonal Antibody; PADI4 (Protein-arginine Deiminase Type IV; Protein-arginine Deiminase Type-4; Peptidylarginine Deiminase IV; HL-60 PAD; PADI5; PDI5) (Biotin); anti-PADI4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4D8
• Specificity: Recognizes human PADI4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 2267

• Applicable Applications for anti-PADI4 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-111 from PADI4 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PADI4 on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-PADI4 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 1519314340
• NCBI GeneID: 23569
• NCBI Accession #: NM_012387.3
• NCBI GenBank Nucleotide #: NM_012387
• UniProt Accession #: Q9UM07
• NCBI Official Full Name: Homo sapiens peptidyl arginine deiminase 4 (PADI4), mRNA
• NCBI Official Synonym Full Names: peptidyl arginine deiminase 4
• NCBI Official Symbol: PADI4
• NCBI Official Synonym Symbols: PAD; PAD4; PDI4; PDI5; PADI5
• NCBI Protein Information: protein-arginine deiminase type-4
• UniProt Protein Name: Protein-arginine deiminase type-4
• Protein Family: Protein-arginine deiminase
• UniProt Gene Name: PADI4
• UniProt Synonym Gene Names: PADI5; PDI5
• UniProt Entry Name: PADI4_HUMAN

NCBI Description

This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. [provided by RefSeq, Jul 2008]

Uniprot Description

PADI4: Catalyzes the citrullination/deimination of arginine residues of proteins. Citrullinates histone H3 at 'Arg-8' and/or 'Arg-17' and histone H4 at 'Arg-3', which prevents their methylation by CARM1 and HRMT1L2/PRMT1 and represses transcription. Citrullinates EP300/P300 at 'Arg-2142', which favors its interaction with NCOA2/GRIP1. Genetic variations in PADI4 are a cause of susceptibility to rheumatoid arthritis (RA). It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures. Could have an important role in the pathogenesis of rheumatoid arthritis by increasing citrullination of proteins in rheumatoid arthritis synovial tissues, leading, in a cytokine-rich milieu, to a break in tolerance to citrullinated peptides processed and presented in the appropriate HLA context. Belongs to the protein arginine deiminase family.

Protein type: Nuclear receptor co-regulator; Hydrolase; EC 3.5.3.15

Chromosomal Location of Human Ortholog: 1p36.13

Cellular Component: cytoplasm; nucleus

Molecular Function: arginine deiminase activity; protein binding; calcium ion binding; protein-arginine deiminase activity

Biological Process: chromatin remodeling; nucleosome assembly; transcription, DNA-dependent; regulation of transcription, DNA-dependent; stem cell maintenance; innate immune response; protein modification process; chromatin modification; peptidyl-citrulline biosynthetic process from peptidyl-arginine

Disease: Rheumatoid Arthritis