Western Blot (WB)
(Western Blot detection against Immunogen (36.45kD).)
Mouse anti-Human MGEA5 Monoclonal Antibody | anti-MGEA5 antibody
MGEA5 (Bifunctional Protein NCOAT, Meningioma-expressed Antigen 5, Nuclear Cytoplasmic O-GlcNAcase and Acetyltransferase, HEXC, KIAA0679, MEA5, FLJ11229, FLJ23355) (Biotin)
Gene Names
OGA; MEA5; MGEA5; NCOAT
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MGEA5; Monoclonal Antibody; MGEA5 (Bifunctional Protein NCOAT; Meningioma-expressed Antigen 5; Nuclear Cytoplasmic O-GlcNAcase and Acetyltransferase; HEXC; KIAA0679; MEA5; FLJ11229; FLJ23355) (Biotin); anti-MGEA5 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C7
Specificity
Recognizes human MGEA5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
916
Applicable Applications for anti-MGEA5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa823-916 from human MGEA5 (NP_036347) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SFHEEQEVLPETFLANFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFPKDVVILGRSL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.45kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.45kD).)
Testing Data
(Detection limit for recombinant GST tagged MGEA5 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MGEA5 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-MGEA5 antibody
Cleaves GlcNAc but not GalNAc from glycopeptides. Can use p-nitrophenyl-beta-GlcNAc as substrate but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc. Possesses hyaluronidase activity. Acetylates 'Lys-8' of histone H4 and 'Lys-14' of histone H3.
Product Categories/Family for anti-MGEA5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein O-GlcNAcase isoform a
NCBI Official Synonym Full Names
O-GlcNAcase
NCBI Official Symbol
OGA
NCBI Official Synonym Symbols
MEA5; MGEA5; NCOAT
NCBI Protein Information
protein O-GlcNAcase
UniProt Protein Name
Protein O-GlcNAcase
Protein Family
UniProt Gene Name
MGEA5
UniProt Synonym Gene Names
HEXC; KIAA0679; MEA5; NCOAT
NCBI Description
The dynamic modification of cytoplasmic and nuclear proteins by O-linked N-acetylglucosamine (O-GlcNAc) addition and removal on serine and threonine residues is catalyzed by OGT (MIM 300255), which adds O-GlcNAc, and MGEA5, a glycosidase that removes O-GlcNAc modifications (Gao et al., 2001 [PubMed 11148210]).[supplied by OMIM, Mar 2008]
Uniprot Description
Isoform 1: Cleaves GlcNAc but not GalNAc from O-glycosylated proteins. Can use p-nitrophenyl-beta-GlcNAc and 4-methylumbelliferone-GlcNAc as substrates but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc (in vitro) (PubMed:11148210). Does not bind acetyl-CoA and does not have histone acetyltransferase activity (PubMed:24088714).
Research Articles on MGEA5
Similar Products
Product Notes
The MGEA5 mgea5 (Catalog #AAA6142921) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MGEA5 (Bifunctional Protein NCOAT, Meningioma-expressed Antigen 5, Nuclear Cytoplasmic O-GlcNAcase and Acetyltransferase, HEXC, KIAA0679, MEA5, FLJ11229, FLJ23355) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MGEA5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MGEA5 mgea5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MGEA5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
