Mouse anti-Human MGAT5 Monoclonal Antibody | anti-MGAT5 antibody

MGAT5 (GGNT5, Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A, Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase, GlcNAc-T V, Mannoside Acetylglucosaminyltransferase 5, N-acetylglucosaminyl-transferase V) (Biotin)

Cat. Num. AAA6142908

• Gene Names: MGAT5; GNT-V; GNT-VA; MGAT5A; glcNAc-T V
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MGAT5; Monoclonal Antibody; MGAT5 (GGNT5; Alpha-1; 6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A; Alpha-mannoside beta-1; 6-N-acetylglucosaminyltransferase; GlcNAc-T V; Mannoside Acetylglucosaminyltransferase 5; N-acetylglucosaminyl-transferase V) (Biotin); anti-MGAT5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E9
• Specificity: Recognizes human MGAT5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 741

• Applicable Applications for anti-MGAT5 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa642-739 from human MGAT5 (NP_002401) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(MGAT5 monoclonal antibody. Western Blot analysis of MGAT5 expression in Jurkat.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MGAT5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MGAT5 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-MGAT5 antibody

Antibodies; Carbohydrates; Glycoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 4505167
• NCBI GeneID: 4249
• NCBI Accession #: NP_002401
• NCBI GenBank Nucleotide #: NM_002410
• UniProt Accession #: Q09328
• NCBI Official Full Name: alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
• NCBI Official Synonym Full Names: alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase
• NCBI Official Symbol: MGAT5
• NCBI Official Synonym Symbols: GNT-V; GNT-VA; MGAT5A; glcNAc-T V
• NCBI Protein Information: alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
• UniProt Protein Name: Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
• Protein Family: Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase
• UniProt Gene Name: MGAT5
• UniProt Synonym Gene Names: GGNT5; GNT-V

NCBI Description

The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated with the progression of invasive malignancies. [provided by RefSeq, Oct 2011]

Uniprot Description

Catalyzes the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides.