Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged IL1R2 is ~3ng/ml as a capture antibody.)

Mouse anti-Human IL1R2 Monoclonal Antibody | anti-IL1R2 antibody

IL1R2 (IL-1RII, Interleukin 1 Receptor Type II, IL-1R2, IL-1R-2, IL-1RT2, IL-1RT-2, CD121 Antigen-like Family Member B, CD121b, CDw121B, Interleukin-1 Receptor beta, IL-1R beta, IL-1R-beta, IL1RB, IL1-Rb, MGC47725) (Biotin)

Gene Names
IL1R2; IL1RB; CD121b; IL1R2c; CDw121b; IL-1R-2; IL-1RT2; IL-1RT-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL1R2; Monoclonal Antibody; IL1R2 (IL-1RII; Interleukin 1 Receptor Type II; IL-1R2; IL-1R-2; IL-1RT2; IL-1RT-2; CD121 Antigen-like Family Member B; CD121b; CDw121B; Interleukin-1 Receptor beta; IL-1R beta; IL-1R-beta; IL1RB; IL1-Rb; MGC47725) (Biotin); anti-IL1R2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G12
Specificity
Recognizes human IL1R2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-IL1R2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa21-121 from IL1R2 (NP_004624) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged IL1R2 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IL1R2 is ~3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between IL1A and IL1R2 HeLa cells were stained with IL1A rabbit purified polyclonal 1:1200 and IL1R2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between IL1A and IL1R2 HeLa cells were stained with IL1A rabbit purified polyclonal 1:1200 and IL1R2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-IL1R2 antibody
The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor that inhibits the activity of its ligands. Interleukin 4 (IL4) is reported to antagonize the activity of interleukin 1 by inducing the expression and release of this cytokine. This gene and three other genes form a cytokine receptor gene cluster on chromosome 2q12. Two alternatively spliced transcript variants encoding the same protein have been reported.
Product Categories/Family for anti-IL1R2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.8kDa (338aa) 40-57kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
interleukin-1 receptor type 2 isoform 1
NCBI Official Synonym Full Names
interleukin 1 receptor type 2
NCBI Official Symbol
IL1R2
NCBI Official Synonym Symbols
IL1RB; CD121b; IL1R2c; CDw121b; IL-1R-2; IL-1RT2; IL-1RT-2
NCBI Protein Information
interleukin-1 receptor type 2
UniProt Protein Name
Interleukin-1 receptor type 2
Protein Family
UniProt Gene Name
IL1R2
UniProt Synonym Gene Names
IL1RB; IL-1R-2; IL-1RT-2; IL-1RT2; IL-1R-beta; mIL-1R2; mIL-1RII; sIL-1R2; sIL-1RII
UniProt Entry Name
IL1R2_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor that inhibits the activity of its ligands. Interleukin 4 (IL4) is reported to antagonize the activity of interleukin 1 by inducing the expression and release of this cytokine. This gene and three other genes form a cytokine receptor gene cluster on chromosome 2q12. Alternative splicing results in multiple transcript variants and protein isoforms. Alternative splicing produces both membrane-bound and soluble proteins. A soluble protein is also produced by proteolytic cleavage. [provided by RefSeq, May 2012]

Uniprot Description

IL-1RB: Non-signaling receptor for IL1A, IL1B and IL1RN. Reduces IL1B activities. Serves as a decoy receptor by competetive binding to IL1B and preventing its binding to IL1R1. Also modulates cellular response through non-signaling association with IL1RAP after binding to IL1B. IL1R2 (membrane and secreted forms) preferentially binds IL1B and poorly IL1A and IL1RN. The secreted IL1R2 recruits secreted IL1RAP with high affinity; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors. Belongs to the interleukin-1 receptor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: integral to membrane; plasma membrane; extracellular region

Molecular Function: protein binding; interleukin-1, Type II, blocking receptor activity; interleukin-1 receptor activity

Biological Process: cytokine and chemokine mediated signaling pathway; immune response

Research Articles on IL1R2

Similar Products

Product Notes

The IL1R2 il1r2 (Catalog #AAA6142458) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL1R2 (IL-1RII, Interleukin 1 Receptor Type II, IL-1R2, IL-1R-2, IL-1RT2, IL-1RT-2, CD121 Antigen-like Family Member B, CD121b, CDw121B, Interleukin-1 Receptor beta, IL-1R beta, IL-1R-beta, IL1RB, IL1-Rb, MGC47725) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL1R2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL1R2 il1r2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL1R2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.