Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human IKK alpha Monoclonal Antibody | anti-IKK-A antibody

IKK alpha (Inhibitor Of Nuclear Factor kappa-B Kinase alpha Subunit, I kappa-B Kinase alpha, IkBKA, IKK-A, IkappaB Kinase, I-kappa-B Kinase 1, IKK1, Conserved Helix-loop-Helix Ubiquitous Kinase, Nuclear Factor NFkappaB Inhibitor Kinase alpha, NFKBIKA, Tra

Gene Names
CHUK; IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IKK alpha; Monoclonal Antibody; IKK alpha (Inhibitor Of Nuclear Factor kappa-B Kinase alpha Subunit; I kappa-B Kinase alpha; IkBKA; IKK-A; IkappaB Kinase; I-kappa-B Kinase 1; IKK1; Conserved Helix-loop-Helix Ubiquitous Kinase; Nuclear Factor NFkappaB Inhibitor Kinase alpha; NFKBIKA; Tra; anti-IKK-A antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G4
Specificity
Recognizes human CHUK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-IKK-A antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa646-745 from human CHUK (NP_001269) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(CHUK monoclonal antibody. Western Blot analysis of CHUK expression in Jurkat.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CHUK on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CHUK on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between IKBKB and CHUK. HeLa cells were stained with IKBKB rabbit purified polyclonal 1:1200 and CHUK mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Product Categories/Family for anti-IKK-A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
84,640 Da
NCBI Official Full Name
inhibitor of nuclear factor kappa-B kinase subunit alpha
NCBI Official Synonym Full Names
conserved helix-loop-helix ubiquitous kinase
NCBI Official Symbol
CHUK
NCBI Official Synonym Symbols
IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha
NCBI Protein Information
inhibitor of nuclear factor kappa-B kinase subunit alpha

NCBI Description

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [provided by RefSeq, Jul 2008]

Research Articles on IKK-A

Similar Products

Product Notes

The IKK-A (Catalog #AAA6142441) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IKK alpha (Inhibitor Of Nuclear Factor kappa-B Kinase alpha Subunit, I kappa-B Kinase alpha, IkBKA, IKK-A, IkappaB Kinase, I-kappa-B Kinase 1, IKK1, Conserved Helix-loop-Helix Ubiquitous Kinase, Nuclear Factor NFkappaB Inhibitor Kinase alpha, NFKBIKA, Tra reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IKK alpha can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IKK-A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IKK alpha, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual