Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.34kD).)

Mouse anti-Human HES5 Monoclonal Antibody | anti-HES5 antibody

HES5 (Transcription Factor HES-5, Class B Basic Helix-loop-helix Protein 38, bHLHb38, Hairy and Enhancer of Split 5, BHLHB38) (Biotin)

Gene Names
HES5; bHLHb38
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HES5; Monoclonal Antibody; HES5 (Transcription Factor HES-5; Class B Basic Helix-loop-helix Protein 38; bHLHb38; Hairy and Enhancer of Split 5; BHLHB38) (Biotin); anti-HES5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C5
Specificity
Recognizes human HES5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HES5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa28-121 from human HES5 (NP_001010926) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.34kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.34kD).)
Related Product Information for anti-HES5 antibody
Transcriptional repressor of genes that require a bHLH protein for their transcription.
Product Categories/Family for anti-HES5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 18 kDa

Observed: 17 kDa
NCBI Official Full Name
transcription factor HES-5
NCBI Official Synonym Full Names
hes family bHLH transcription factor 5
NCBI Official Symbol
HES5
NCBI Official Synonym Symbols
bHLHb38
NCBI Protein Information
transcription factor HES-5; hairy and enhancer of split 5; class B basic helix-loop-helix protein 38
UniProt Protein Name
Transcription factor HES-5
Protein Family
UniProt Gene Name
HES5
UniProt Synonym Gene Names
BHLHB38; bHLHb38
UniProt Entry Name
HES5_HUMAN

NCBI Description

This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq, Dec 2008]

Uniprot Description

HES5: Transcriptional repressor of genes that require a bHLH protein for their transcription.

Protein type: Transcription regulation; Cell development/differentiation

Chromosomal Location of Human Ortholog: 1p36.32

Cellular Component: nucleoplasm

Molecular Function: protein dimerization activity; double-stranded DNA binding; chromatin binding; transcription factor binding

Biological Process: neural tube development; radial glial cell differentiation in the forebrain; regulation of myelination; positive regulation of transcription, DNA-dependent; positive regulation of smooth muscle cell proliferation; cell maturation; positive regulation of JAK-STAT cascade; auditory receptor cell differentiation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of tyrosine phosphorylation of Stat3 protein; regulation of neurogenesis; astrocyte differentiation; regulation of cell differentiation; positive regulation of cell proliferation; chondrocyte differentiation; protein complex assembly; cell adhesion; oligodendrocyte development; positive regulation of BMP signaling pathway; positive regulation of Notch signaling pathway; smoothened signaling pathway; Notch signaling pathway; camera-type eye development; auditory receptor cell fate determination; transcription, DNA-dependent; myelination in the central nervous system; negative regulation of oligodendrocyte differentiation; negative regulation of neuron differentiation; telencephalon development; glial cell fate commitment; cartilage development; negative regulation of astrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; brain development

Research Articles on HES5

Similar Products

Product Notes

The HES5 hes5 (Catalog #AAA6142262) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HES5 (Transcription Factor HES-5, Class B Basic Helix-loop-helix Protein 38, bHLHb38, Hairy and Enhancer of Split 5, BHLHB38) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HES5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HES5 hes5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HES5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.