Mouse anti-Human HES5 Monoclonal Antibody | anti-HES5 antibody

HES5 (Transcription Factor HES-5, Class B Basic Helix-loop-helix Protein 38, bHLHb38, Hairy and Enhancer of Split 5, BHLHB38) (HRP)

Cat. Num. AAA6152868

• Gene Names: HES5; bHLHb38
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HES5; Monoclonal Antibody; HES5 (Transcription Factor HES-5; Class B Basic Helix-loop-helix Protein 38; bHLHb38; Hairy and Enhancer of Split 5; BHLHB38) (HRP); anti-HES5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3C5
• Specificity: Recognizes human HES5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-HES5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Recombinant protein corresponding to aa28-121 from human HES5 (NP_001010926) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.34kD).)

Related Product Information for anti-HES5 antibody

Transcriptional repressor of genes that require a bHLH protein for their transcription.

Product Categories/Family for anti-HES5 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 58219048
• NCBI GeneID: 388585
• NCBI Accession #: NP_001010926
• NCBI GenBank Nucleotide #: NM_001010926
• UniProt Accession #: Q5TA89; B9DI85
• Molecular Weight: Predicted: 18 kDa; ; Observed: 17 kDa
• NCBI Official Full Name: transcription factor HES-5
• NCBI Official Synonym Full Names: hes family bHLH transcription factor 5
• NCBI Official Symbol: HES5
• NCBI Official Synonym Symbols: bHLHb38
• NCBI Protein Information: transcription factor HES-5; hairy and enhancer of split 5; class B basic helix-loop-helix protein 38
• UniProt Protein Name: Transcription factor HES-5
• Protein Family: Transcription factor
• UniProt Gene Name: HES5
• UniProt Synonym Gene Names: BHLHB38; bHLHb38
• UniProt Entry Name: HES5_HUMAN

NCBI Description

This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq, Dec 2008]

Uniprot Description

HES5: Transcriptional repressor of genes that require a bHLH protein for their transcription.

Protein type: Transcription regulation; Cell development/differentiation

Chromosomal Location of Human Ortholog: 1p36.32

Cellular Component: nucleoplasm

Molecular Function: protein dimerization activity; double-stranded DNA binding; chromatin binding; transcription factor binding

Biological Process: neural tube development; radial glial cell differentiation in the forebrain; regulation of myelination; positive regulation of transcription, DNA-dependent; positive regulation of smooth muscle cell proliferation; cell maturation; positive regulation of JAK-STAT cascade; auditory receptor cell differentiation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of tyrosine phosphorylation of Stat3 protein; regulation of neurogenesis; astrocyte differentiation; regulation of cell differentiation; positive regulation of cell proliferation; chondrocyte differentiation; protein complex assembly; cell adhesion; oligodendrocyte development; positive regulation of BMP signaling pathway; positive regulation of Notch signaling pathway; smoothened signaling pathway; Notch signaling pathway; camera-type eye development; auditory receptor cell fate determination; transcription, DNA-dependent; myelination in the central nervous system; negative regulation of oligodendrocyte differentiation; negative regulation of neuron differentiation; telencephalon development; glial cell fate commitment; cartilage development; negative regulation of astrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; brain development