Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human FZD7 Monoclonal Antibody | anti-FZD7 antibody

FZD7 (Frizzled-7, Fz-7, hFz7, FzE3) (Biotin)

Gene Names
FZD7; FzE3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FZD7; Monoclonal Antibody; FZD7 (Frizzled-7; Fz-7; hFz7; FzE3) (Biotin); anti-FZD7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D9
Specificity
Recognizes human FZD7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FZD7 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa155-254 from FZD7 (NP_003498) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFA*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(FZD7 monoclonal antibody Western Blot analysis of FZD7 expression in K-562.)

Western Blot (WB) (FZD7 monoclonal antibody Western Blot analysis of FZD7 expression in K-562.)

Immunohistochemistry (IHC)

(immunoperoxidase of monoclonal antibody to FZD7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (immunoperoxidase of monoclonal antibody to FZD7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged FZD7 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FZD7 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-FZD7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,620 Da
NCBI Official Full Name
frizzled-7
NCBI Official Synonym Full Names
frizzled class receptor 7
NCBI Official Symbol
FZD7
NCBI Official Synonym Symbols
FzE3
NCBI Protein Information
frizzled-7
UniProt Protein Name
Frizzled-7
Protein Family
UniProt Gene Name
FZD7
UniProt Synonym Gene Names
Fz-7; hFz7
UniProt Entry Name
FZD7_HUMAN

NCBI Description

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas. [provided by RefSeq, Jul 2008]

Uniprot Description

FZD7: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK- 3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: Receptor, GPCR; Motility/polarity/chemotaxis; Membrane protein, multi-pass; GPCR, Fz/Smo family; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q33

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; Wnt-protein binding; Wnt receptor activity; protein binding; frizzled binding; PDZ domain binding

Biological Process: neuron differentiation; G-protein coupled receptor protein signaling pathway; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; positive regulation of epithelial cell proliferation involved in wound healing; stem cell maintenance; T cell differentiation in the thymus; positive regulation of JNK cascade; somatic stem cell division; Wnt receptor signaling pathway through beta-catenin; satellite cell compartment self-renewal involved in skeletal muscle regeneration; negative regulation of ectodermal cell fate specification; positive regulation of phosphorylation

Research Articles on FZD7

Similar Products

Product Notes

The FZD7 fzd7 (Catalog #AAA6141992) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FZD7 (Frizzled-7, Fz-7, hFz7, FzE3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FZD7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FZD7 fzd7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FZD7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.