Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF10. HeLa cells were stained with FGFR2 rabbit purified polyclonal 1:1200 and FGF10 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Mouse anti-Human FGF10 Monoclonal Antibody | anti-FGF10 antibody

FGF10 (Fibroblast Growth Factor 10, FGF-10, Keratinocyte Growth Factor 2) (Biotin)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FGF10; Monoclonal Antibody; FGF10 (Fibroblast Growth Factor 10; FGF-10; Keratinocyte Growth Factor 2) (Biotin); anti-FGF10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C7
Specificity
Recognizes human FGF10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FGF10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa38-137 from human FGF10 (NP_004456) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF10. HeLa cells were stained with FGFR2 rabbit purified polyclonal 1:1200 and FGF10 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF10. HeLa cells were stained with FGFR2 rabbit purified polyclonal 1:1200 and FGF10 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Related Product Information for anti-FGF10 antibody
Fibroblast Growth Factor-10 (also called KGF-2) is a heparin binding growth factor that stimulates the proliferation and activation of cells that express FGF receptors. FGF-10 is mostly related to FGF-7/KGF and is expressed during development and preferentially in adult lungs.
Product Categories/Family for anti-FGF10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22.0 kDa (196aa) confirmed by MALDI-TOF
NCBI Official Full Name
fibroblast growth factor 10
NCBI Official Synonym Full Names
fibroblast growth factor 10
NCBI Official Symbol
FGF10
NCBI Protein Information
fibroblast growth factor 10
UniProt Protein Name
Fibroblast growth factor 10
Protein Family
UniProt Gene Name
FGF10
UniProt Synonym Gene Names
FGF-10
UniProt Entry Name
FGF10_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF10: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing. Interacts with FGFR1 and FGFR2. Interacts with FGFBP1. Belongs to the heparin-binding growth factors family.

Protein type: Cell development/differentiation; Cytokine; Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5p13-p12

Cellular Component: extracellular matrix; extracellular space; cell surface; plasma membrane; extracellular region; nucleus

Molecular Function: heparin binding; protein binding; growth factor activity; type 2 fibroblast growth factor receptor binding; fibroblast growth factor receptor binding; chemoattractant activity

Biological Process: nerve growth factor receptor signaling pathway; salivary gland development; urothelial cell proliferation; somatic stem cell maintenance; activation of MAPK activity; positive regulation of epithelial cell proliferation involved in wound healing; positive regulation of transcription, DNA-dependent; muscle cell fate commitment; response to lipopolysaccharide; regulation of saliva secretion; embryonic pattern specification; G1/S-specific positive regulation of cyclin-dependent protein kinase activity; positive regulation of fibroblast proliferation; epithelial cell proliferation; positive chemotaxis; embryonic digestive tract morphogenesis; induction of an organ; mesonephros development; embryonic genitalia morphogenesis; positive regulation of keratinocyte migration; spleen development; positive regulation of DNA repair; fibroblast growth factor receptor signaling pathway; positive regulation of urothelial cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; branching morphogenesis of a tube; smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; determination of left/right symmetry; metanephros development; positive regulation of epithelial cell proliferation; wound healing; radial glial cell differentiation; positive regulation of mitotic cell cycle; response to estradiol stimulus; positive regulation of vascular endothelial growth factor receptor signaling pathway; induction of positive chemotaxis; negative regulation of cell proliferation; positive regulation of MAPKKK cascade; establishment of mitotic spindle orientation; positive regulation of lymphocyte proliferation; tissue regeneration; male genitalia morphogenesis; pancreas development; thyroid gland development; lacrimal gland development; angiogenesis; otic vesicle formation; female genitalia morphogenesis; positive regulation of Notch signaling pathway; epidermal growth factor receptor signaling pathway; phosphoinositide-mediated signaling; hair follicle morphogenesis; thymus development; keratinocyte proliferation; regulation of activin receptor signaling pathway; embryonic camera-type eye development; odontogenesis of dentine-containing teeth; limb bud formation; pituitary gland development; positive regulation of ATPase activity; actin cytoskeleton reorganization; white fat cell differentiation; insulin receptor signaling pathway; innate immune response; blood vessel remodeling; positive regulation of Ras protein signal transduction; positive regulation of DNA replication; regulation of smoothened signaling pathway

Disease: Lacrimoauriculodentodigital Syndrome; Aplasia Of Lacrimal And Salivary Glands

Research Articles on FGF10

Similar Products

Product Notes

The FGF10 fgf10 (Catalog #AAA6141890) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FGF10 (Fibroblast Growth Factor 10, FGF-10, Keratinocyte Growth Factor 2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FGF10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGF10 fgf10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGF10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.