Mouse anti-Human CCL18 Monoclonal Antibody | anti-CCL18 antibody

CCL18 (C-C Motif Chemokine 18, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-regulated Chemokine, Small-induci

Cat. Num. AAA6141006

• Gene Names: CCL18; CKb7; PARC; AMAC1; DCCK1; MIP-4; AMAC-1; DC-CK1; SCYA18
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CCL18; Monoclonal Antibody; CCL18 (C-C Motif Chemokine 18; Alternative Macrophage Activation-associated CC Chemokine 1; AMAC-1; CC Chemokine PARC; Dendritic Cell Chemokine 1; DC-CK1; Macrophage Inflammatory Protein 4; MIP-4; Pulmonary and Activation-regulated Chemokine; Small-induci; anti-CCL18 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2C6
• Specificity: Recognizes human CCL18.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CCL18 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa21-90 from human CCL18 (NP_002979) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.7kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of CCL18 transfected lysate using CCL18 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CCL18 rabbit polyclonal antibody.)

Related Product Information for anti-CCL18 antibody

Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.

Product Categories/Family for anti-CCL18 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 4506831
• NCBI GeneID: 6362
• NCBI Accession #: NP_002979
• NCBI GenBank Nucleotide #: NM_002988
• UniProt Accession #: P55774; Q53X71; B5BUM2
• Molecular Weight: 10.4 kDa (93aa), confirmed by MALDI-TOF
• NCBI Official Full Name: C-C motif chemokine 18
• NCBI Official Synonym Full Names: C-C motif chemokine ligand 18
• NCBI Official Symbol: CCL18
• NCBI Official Synonym Symbols: CKb7; PARC; AMAC1; DCCK1; MIP-4; AMAC-1; DC-CK1; SCYA18
• NCBI Protein Information: C-C motif chemokine 18
• UniProt Protein Name: C-C motif chemokine 18
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL18
• UniProt Synonym Gene Names: AMAC1; DCCK1; MIP4; PARC; SCYA18; AMAC-1; DC-CK1; MIP-4
• UniProt Entry Name: CCL18_HUMAN

NCBI Description

This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq, Sep 2014]

Uniprot Description

CCL18: Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted; Chemokine

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space

Molecular Function: protein binding; chemokine activity

Biological Process: cell-cell signaling; response to biotic stimulus; immune response; cell communication; chemotaxis; signal transduction; inflammatory response