Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (71.61kD) using 124276.)

Mouse anti-Human Calreticulin Monoclonal Antibody | anti-CRTC antibody

Calreticulin (CRP55, Calregulin, Endoplasmic Reticulum Resident Protein 60, ERp60, HACBP, grp60, CRTC, CALR) (Biotin)

Gene Names
CALR; RO; CRT; SSA; cC1qR; HEL-S-99n
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Calreticulin; Monoclonal Antibody; Calreticulin (CRP55; Calregulin; Endoplasmic Reticulum Resident Protein 60; ERp60; HACBP; grp60; CRTC; CALR) (Biotin); anti-CRTC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G11-1A9
Specificity
Recognizes human Calreticulin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CRTC antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-417 from human Calreticulin with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (71.61kD) using 124276.)

Western Blot (WB) (Western Blot detection against Immunogen (71.61kD) using 124276.)

Western Blot (WB)

(Western Blot analysis of CALR expression in K-562 using 124276.)

Western Blot (WB) (Western Blot analysis of CALR expression in K-562 using 124276.)

Western Blot (WB)

(Western Blot analysis of CALR expression in transfected 293T cell line using 124276. Lane 1: CALR transfected lysate (48kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CALR expression in transfected 293T cell line using 124276. Lane 1: CALR transfected lysate (48kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunohistochemistry analysis of formalin-fixed paraffin-embedded human colon tissue using 124276 and Immunoperoxidase.)

Immunohistochemistry (IHC) (Immunohistochemistry analysis of formalin-fixed paraffin-embedded human colon tissue using 124276 and Immunoperoxidase.)
Product Categories/Family for anti-CRTC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
811
Molecular Weight
48,142 Da
NCBI Official Full Name
Homo sapiens calreticulin, mRNA
NCBI Official Synonym Full Names
calreticulin
NCBI Official Symbol
CALR
NCBI Official Synonym Symbols
RO; CRT; SSA; cC1qR; HEL-S-99n
NCBI Protein Information
calreticulin
Protein Family

NCBI Description

Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium. The amino terminus of calreticulin interacts with the DNA-binding domain of the glucocorticoid receptor and prevents the receptor from binding to its specific glucocorticoid response element. Calreticulin can inhibit the binding of androgen receptor to its hormone-responsive DNA element and can inhibit androgen receptor and retinoic acid receptor transcriptional activities in vivo, as well as retinoic acid-induced neuronal differentiation. Thus, calreticulin can act as an important modulator of the regulation of gene transcription by nuclear hormone receptors. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin but calreticulin is not a Ro/SS-A antigen. Earlier papers referred to calreticulin as an Ro/SS-A antigen but this was later disproven. Increased autoantibody titer against human calreticulin is found in infants with complete congenital heart block of both the IgG and IgM classes. [provided by RefSeq, Jul 2008]

Research Articles on CRTC

Similar Products

Product Notes

The CRTC (Catalog #AAA6140945) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Calreticulin (CRP55, Calregulin, Endoplasmic Reticulum Resident Protein 60, ERp60, HACBP, grp60, CRTC, CALR) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Calreticulin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRTC for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Calreticulin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.