Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ATP6V1B1 is 0.3ng/ml as a capture antibody.)

Mouse anti-Human ATP6V1B1 Monoclonal Antibody | anti-ATP6V1B1 antibody

ATP6V1B1 (V-type Proton ATPase Subunit B, Kidney Isoform, V-ATPase Subunit B 1, Endomembrane Proton Pump 58kD Subunit, Vacuolar Proton Pump Subunit B 1, ATP6B1, VATB, VPP3) (Biotin)

Gene Names
ATP6V1B1; VATB; VMA2; VPP3; RTA1B; ATP6B1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP6V1B1; Monoclonal Antibody; ATP6V1B1 (V-type Proton ATPase Subunit B; Kidney Isoform; V-ATPase Subunit B 1; Endomembrane Proton Pump 58kD Subunit; Vacuolar Proton Pump Subunit B 1; ATP6B1; VATB; VPP3) (Biotin); anti-ATP6V1B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G11
Specificity
Recognizes human ATP6V1B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ATP6V1B1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-75 from human ATP6V1B1 (NP_001683.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIVHFTLPDGTQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ATP6V1B1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ATP6V1B1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-ATP6V1B1 antibody
Non-catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Product Categories/Family for anti-ATP6V1B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
525
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,833 Da
NCBI Official Full Name
V-type proton ATPase subunit B, kidney isoform
NCBI Official Synonym Full Names
ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1
NCBI Official Symbol
ATP6V1B1
NCBI Official Synonym Symbols
VATB; VMA2; VPP3; RTA1B; ATP6B1
NCBI Protein Information
V-type proton ATPase subunit B, kidney isoform; V-ATPase B1 subunit; V-ATPase subunit B 1; vacuolar proton pump 3; H+-ATPase beta 1 subunit; vacuolar proton pump, subunit 3; vacuolar proton pump subunit B 1; endomembrane proton pump 58 kDa subunit; H(+)-t
UniProt Protein Name
V-type proton ATPase subunit B, kidney isoform
Protein Family
UniProt Gene Name
ATP6V1B1
UniProt Synonym Gene Names
ATP6B1; VATB; VPP3; V-ATPase subunit B 1
UniProt Entry Name
VATB1_HUMAN

NCBI Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain B subunit isoforms and is found in the kidney. Mutations in this gene cause distal renal tubular acidosis associated with sensorineural deafness. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP6V1B1: Non-catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Defects in ATP6V1B1 are the cause of distal renal tubular acidosis with deafness (dRTA-D). Inheritance is autosomal recessive. Patients with recessive dRTA are severely affected, presenting with either acute illness or growth failure at a young age, and bilateral sensorineural deafness. Other features include low serum K(+) due to renal potassium wasting, and elevated urinary calcium. If untreated, this acidosis may result in dissolution of bone, leading to osteomalacia and rickets. Renal deposition of calcium salts (nephrocalcinosis) and renal stone formation commonly occur. Belongs to the ATPase alpha/beta chains family.

Protein type: Hydrolase; EC 3.6.3.14; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 2p13.1

Cellular Component: microvillus; basolateral plasma membrane; apical plasma membrane; cytoplasm; endomembrane system; vacuolar proton-transporting V-type ATPase complex; cytosol; lateral plasma membrane

Molecular Function: protein complex binding; hydrogen ion transmembrane transporter activity; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; ATP binding

Biological Process: interaction with host; inner ear morphogenesis; ossification; cellular iron ion homeostasis; transferrin transport; excretion; calcium ion homeostasis; ATP metabolic process; proton transport; sensory perception of sound; ATP hydrolysis coupled proton transport; pH reduction; insulin receptor signaling pathway; regulation of pH; transmembrane transport

Disease: Renal Tubular Acidosis, Distal, With Progressive Nerve Deafness

Research Articles on ATP6V1B1

Similar Products

Product Notes

The ATP6V1B1 atp6v1b1 (Catalog #AAA6140740) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP6V1B1 (V-type Proton ATPase Subunit B, Kidney Isoform, V-ATPase Subunit B 1, Endomembrane Proton Pump 58kD Subunit, Vacuolar Proton Pump Subunit B 1, ATP6B1, VATB, VPP3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6V1B1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP6V1B1 atp6v1b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP6V1B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.