Mouse anti-Human AIP Monoclonal Antibody | anti-AIP antibody

AIP (AH Receptor-interacting Protein, Aryl-hydrocarbon Receptor-interacting Protein, HBV X-associated Protein 2, XAP-2, Immunophilin Homolog ARA9, XAP2) (Biotin)

Cat. Num. AAA6140529

• Gene Names: AIP; ARA9; XAP2; XAP-2; FKBP16; FKBP37; SMTPHN
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AIP; Monoclonal Antibody; AIP (AH Receptor-interacting Protein; Aryl-hydrocarbon Receptor-interacting Protein; HBV X-associated Protein 2; XAP-2; Immunophilin Homolog ARA9; XAP2) (Biotin); anti-AIP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3D3
• Specificity: Recognizes human AIP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-AIP antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa156-250 from AIP (NP_003968) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.45kD).)

Testing Data

(Detection limit for recombinant GST tagged AIP is 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(AIP monoclonal antibody Western Blot analysis of AIP expression in HepG2.)

Related Product Information for anti-AIP antibody

Ah receptor-associated protein (AIP) is also known as ARA9 and XAP2. This protein displays structural similarity to the glucocorticoid receptor-associated immunophilin FKBP52. Although they share significant homology, they have distinct cellular roles and biochemical properties. AIP is known to affect the potency and efficacy of AHR agonists in the yeast Saccharomyces cerevisiae as well as having functional consequence on AHR signal transduction.

Product Categories/Family for anti-AIP antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 729042247
• NCBI GeneID: 9049
• NCBI Accession #: NP_003968
• NCBI GenBank Nucleotide #: NM_003977
• UniProt Accession #: O00170; Q2M3Q2; Q99606; A0SZW3; A0SZW4; A0SZW5; A0SZW6
• Molecular Weight: 37,636 Da
• NCBI Official Full Name: AH receptor-interacting protein isoform 1
• NCBI Official Synonym Full Names: aryl hydrocarbon receptor interacting protein
• NCBI Official Symbol: AIP
• NCBI Official Synonym Symbols: ARA9; XAP2; XAP-2; FKBP16; FKBP37; SMTPHN
• NCBI Protein Information: AH receptor-interacting protein; HBV X-associated protein 2; immunophilin homolog ARA9
• UniProt Protein Name: AH receptor-interacting protein
• Protein Family: AH receptor-interacting protein
• UniProt Gene Name: AIP
• UniProt Synonym Gene Names: XAP2; AIP; XAP-2
• UniProt Entry Name: AIP_HUMAN

Uniprot Description

AIP: May play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting. Defects in AIP are a cause of growth hormone-secreting pituitary adenoma (GHSPA); also known as familial isolated somatotropinomas (FIS) or isolated familial somatotropinoma (IFS) or familial somatotrophinoma or acromegaly due to pituitary adenoma. Defects in AIP are a cause of ACTH-secreting pituitary adenoma (ASPA); also known as pituitary Cushing disease. A pituary adenoma resulting in excessive production of adrenocorticotropic hormone. This leads to hypersecretion of cortisol by the adrenal glands and ACTH-dependent Cushing syndrome. Clinical manifestations of Cushing syndrome include facial and trunkal obesity, abdominal striae, muscular weakness, osteoporosis, arterial hypertension, diabetes. Defects in AIP are a cause of prolactin-secreting pituitary adenoma (PSPA); also known as prolactinoma. Prolactin-secreting pituitary adenoma is the most common type of hormonally active pituitary adenoma.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 11q13.3

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; signal transducer activity; transcription coactivator activity; unfolded protein binding; transcription factor binding

Biological Process: protein maturation via protein folding; xenobiotic metabolic process; signal transduction; negative regulation of cyclic-nucleotide phosphodiesterase activity; protein targeting to mitochondrion

Disease: Pituitary Adenoma, Prolactin-secreting; Pituitary Adenoma, Acth-secreting; Pituitary Adenoma, Growth Hormone-secreting