Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.45kD).)

Mouse anti-Human AIP Monoclonal Antibody | anti-AIP antibody

AIP (AH Receptor-interacting Protein, Aryl-hydrocarbon Receptor-interacting Protein, HBV X-associated Protein 2, XAP-2, Immunophilin Homolog ARA9, XAP2) (FITC)

Gene Names
AIP; ARA9; XAP2; XAP-2; FKBP16; FKBP37; SMTPHN
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AIP; Monoclonal Antibody; AIP (AH Receptor-interacting Protein; Aryl-hydrocarbon Receptor-interacting Protein; HBV X-associated Protein 2; XAP-2; Immunophilin Homolog ARA9; XAP2) (FITC); anti-AIP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D3
Specificity
Recognizes human AIP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-AIP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa156-250 from AIP (NP_003968) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.45kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.45kD).)

Testing Data

(Detection limit for recombinant GST tagged AIP is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AIP is 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(AIP monoclonal antibody Western Blot analysis of AIP expression in HepG2.)

Western Blot (WB) (AIP monoclonal antibody Western Blot analysis of AIP expression in HepG2.)
Related Product Information for anti-AIP antibody
Ah receptor-associated protein (AIP) is also known as ARA9 and XAP2. This protein displays structural similarity to the glucocorticoid receptor-associated immunophilin FKBP52. Although they share significant homology, they have distinct cellular roles and biochemical properties. AIP is known to affect the potency and efficacy of AHR agonists in the yeast Saccharomyces cerevisiae as well as having functional consequence on AHR signal transduction.
Product Categories/Family for anti-AIP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,636 Da
NCBI Official Full Name
AH receptor-interacting protein isoform 1
NCBI Official Synonym Full Names
aryl hydrocarbon receptor interacting protein
NCBI Official Symbol
AIP
NCBI Official Synonym Symbols
ARA9; XAP2; XAP-2; FKBP16; FKBP37; SMTPHN
NCBI Protein Information
AH receptor-interacting protein; HBV X-associated protein 2; immunophilin homolog ARA9
UniProt Protein Name
AH receptor-interacting protein
UniProt Gene Name
AIP
UniProt Synonym Gene Names
XAP2; AIP; XAP-2
UniProt Entry Name
AIP_HUMAN

Uniprot Description

AIP: May play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting. Defects in AIP are a cause of growth hormone-secreting pituitary adenoma (GHSPA); also known as familial isolated somatotropinomas (FIS) or isolated familial somatotropinoma (IFS) or familial somatotrophinoma or acromegaly due to pituitary adenoma. Defects in AIP are a cause of ACTH-secreting pituitary adenoma (ASPA); also known as pituitary Cushing disease. A pituary adenoma resulting in excessive production of adrenocorticotropic hormone. This leads to hypersecretion of cortisol by the adrenal glands and ACTH-dependent Cushing syndrome. Clinical manifestations of Cushing syndrome include facial and trunkal obesity, abdominal striae, muscular weakness, osteoporosis, arterial hypertension, diabetes. Defects in AIP are a cause of prolactin-secreting pituitary adenoma (PSPA); also known as prolactinoma. Prolactin-secreting pituitary adenoma is the most common type of hormonally active pituitary adenoma.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 11q13.3

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; signal transducer activity; transcription coactivator activity; unfolded protein binding; transcription factor binding

Biological Process: protein maturation via protein folding; xenobiotic metabolic process; signal transduction; negative regulation of cyclic-nucleotide phosphodiesterase activity; protein targeting to mitochondrion

Disease: Pituitary Adenoma, Prolactin-secreting; Pituitary Adenoma, Acth-secreting; Pituitary Adenoma, Growth Hormone-secreting

Similar Products

Product Notes

The AIP aip (Catalog #AAA6145832) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AIP (AH Receptor-interacting Protein, Aryl-hydrocarbon Receptor-interacting Protein, HBV X-associated Protein 2, XAP-2, Immunophilin Homolog ARA9, XAP2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AIP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AIP aip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AIP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.