Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PACAP Type I Receptor Monoclonal Antibody | anti-PACAP-R1 antibody

PACAP Type I Receptor (Pituitary Adenylate Cyclase-activating Polypeptide Type I Receptor, PACAP-R-1, PACAP-R1, ADCYAP1R1) (Biotin)

Gene Names
ADCYAP1R1; PAC1; PAC1R; PACAPR; PACAPRI
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
PACAP Type I Receptor; Monoclonal Antibody; PACAP Type I Receptor (Pituitary Adenylate Cyclase-activating Polypeptide Type I Receptor; PACAP-R-1; PACAP-R1; ADCYAP1R1) (Biotin); anti-PACAP-R1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B12
Specificity
Recognizes human PACAP Type 1 Receptor.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PACAP-R1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa21-120 from human PACAP Type 1 Receptor with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-PACAP-R1 antibody
The PACAP receptor type 1, a member of the vasoactive intestinal polypeptide subfamily, binds the hormone pituitary adenylate cyclase activating polypeptide (PACAP) with high affinity. PACAP is involved in stimulating the secretion of insulin, catecholamines, ACTH, and growth hormone. Additionally, PACAP appears to function as a neuromodulator/neurotransmitter in the central and peripheral nervous systems. Two start codons are reported in literature, one (nt 74-76) results in a 525aa protein with a signal peptide of 77aa encoded by nt 74-304 and the second (nt 245-247) initiates a 468aa protein with a signal peptide of 20aa encoded by nt 245-304. The efficiency of these two start codons is not known. PACAP receptor type 1 expression has been documented in adipose, adrenal, bone, brain, colon, ganglion, heart, lung, ovary, pancreas, placenta, spleen, and uterus. ESTs have been isolated from brain and nerve libraries.
Product Categories/Family for anti-PACAP-R1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
117
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
Pituitary adenylate cyclase-activating polypeptide type I receptor
NCBI Official Synonym Full Names
ADCYAP receptor type I
NCBI Official Symbol
ADCYAP1R1
NCBI Official Synonym Symbols
PAC1; PAC1R; PACAPR; PACAPRI
NCBI Protein Information
pituitary adenylate cyclase-activating polypeptide type I receptor
UniProt Protein Name
Pituitary adenylate cyclase-activating polypeptide type I receptor
UniProt Gene Name
ADCYAP1R1
UniProt Synonym Gene Names
PACAP type I receptor; PACAP-R-1; PACAP-R1
UniProt Entry Name
PACR_HUMAN

NCBI Description

This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2010]

Uniprot Description

ADCYAP1R1: This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract. Belongs to the G-protein coupled receptor 2 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 2; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7p14

Cellular Component: neuron projection; cell surface; tight junction; rough endoplasmic reticulum; integral to plasma membrane; plasma membrane; caveola; receptor complex; endosome

Molecular Function: ADP-ribosylation factor binding; neuropeptide binding; vasoactive intestinal polypeptide receptor activity; protein binding; receptor activity; adenylate cyclase binding

Biological Process: response to drug; G-protein coupled receptor protein signaling pathway; development of primary female sexual characteristics; cAMP-mediated signaling; response to ethanol; cell surface receptor linked signal transduction; nerve growth factor receptor signaling pathway; phospholipase C activation; adenylate cyclase activation; spermatogenesis; cell differentiation; multicellular organismal response to stress; response to estradiol stimulus; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on PACAP-R1

Similar Products

Product Notes

The PACAP-R1 adcyap1r1 (Catalog #AAA6140361) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PACAP Type I Receptor (Pituitary Adenylate Cyclase-activating Polypeptide Type I Receptor, PACAP-R-1, PACAP-R1, ADCYAP1R1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PACAP Type I Receptor can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PACAP-R1 adcyap1r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PACAP Type I Receptor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.