Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ROR1 Monoclonal Antibody | anti-ROR1 antibody

ROR1 (Receptor Tyrosine Kinase-like Orphan Receptor 1, OTTHUMP00000010573, OTTHUMP00000010574, Neurotrophic Tyrosine Kinase Receptor-related 1, MGC99659, NTRKR1, dJ537F10.1) APC

Gene Names
ROR1; NTRKR1; dJ537F10.1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ROR1; Monoclonal Antibody; ROR1 (Receptor Tyrosine Kinase-like Orphan Receptor 1; OTTHUMP00000010573; OTTHUMP00000010574; Neurotrophic Tyrosine Kinase Receptor-related 1; MGC99659; NTRKR1; dJ537F10.1) APC; anti-ROR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F8
Specificity
Recognizes human ROR1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ROR1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa294-393 from human ROR1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ROR1 antibody
The protein encoded by this gene is a receptor protein tyrosine kinase that modulates neurite growth in the central nervous system. It is a type I membrane protein and belongs to the ROR subfamily of cell surface receptors. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-ROR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
43,826 Da
NCBI Official Full Name
Homo sapiens receptor tyrosine kinase-like orphan receptor 1, mRNA
NCBI Official Synonym Full Names
receptor tyrosine kinase like orphan receptor 1
NCBI Official Symbol
ROR1
NCBI Official Synonym Symbols
NTRKR1; dJ537F10.1
NCBI Protein Information
inactive tyrosine-protein kinase transmembrane receptor ROR1

NCBI Description

This gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. It is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signalling pathway. This gene is highly expressed during early embryonic development but expressed at very low levels in adult tissues. Increased expression of this gene is associated with B-cell chronic lymphocytic leukaemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2012]

Research Articles on ROR1

Similar Products

Product Notes

The ROR1 (Catalog #AAA6140241) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ROR1 (Receptor Tyrosine Kinase-like Orphan Receptor 1, OTTHUMP00000010573, OTTHUMP00000010574, Neurotrophic Tyrosine Kinase Receptor-related 1, MGC99659, NTRKR1, dJ537F10.1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ROR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ROR1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ROR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.