Mouse anti-Human Thioredoxin Monoclonal Antibody | anti-TRDX antibody

Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) APC

Cat. Num. AAA6139695

• Gene Names: TXN; TRX; TRDX; TRX1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Thioredoxin; Monoclonal Antibody; Thioredoxin (TRDX; Trx; TRX1; TXN; ATL-derived Factor; ADF; Surface-associated Sulphydryl Protein; SASP) APC; anti-TRDX antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A7
• Specificity: Recognizes human TXN.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-TRDX antibody: ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-105 from human TXN (AAH03377) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TXN monoclonal antibody Western Blot analysis of TXN expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of TXN expression in transfected 293T cell line by TXN monoclonal antibody. Lane 1: TXN transfected lysate (11.7kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TXN on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of TXN transfected lysate using TXN monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TXN rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged TXN is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TRDX antibody

Antibodies; Thioredoxin

NCBI and Uniprot Product Information

• NCBI GI #: 13097230
• NCBI GeneID: 7295
• UniProt Accession #: P10599; O60744; Q53X69; Q96KI3; Q9UDG5; B1ALW1
• Molecular Weight: Calculated Molecular Weight: 12kDa; Observed Molecular Weight: 12kDa
• NCBI Official Full Name: Homo sapiens thioredoxin, mRNA
• NCBI Official Synonym Full Names: thioredoxin
• NCBI Official Symbol: TXN
• NCBI Official Synonym Symbols: TRX; TRDX; TRX1
• NCBI Protein Information: thioredoxin
• UniProt Protein Name: Thioredoxin
• Protein Family: Thioredoxin
• UniProt Gene Name: TXN
• UniProt Synonym Gene Names: TRDX; TRX; TRX1; Trx; ADF; SASP
• UniProt Entry Name: THIO_HUMAN

NCBI Description

The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]