Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TXN monoclonal antibody Western Blot analysis of TXN expression in HeLa.)

Mouse anti-Human Thioredoxin Monoclonal Antibody | anti-TRDX antibody

Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (FITC)

Gene Names
TXN; TRX; TRDX; TRX1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Thioredoxin; Monoclonal Antibody; Thioredoxin (TRDX; Trx; TRX1; TXN; ATL-derived Factor; ADF; Surface-associated Sulphydryl Protein; SASP) (FITC); anti-TRDX antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A7
Specificity
Recognizes human TXN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TRDX antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-105 from human TXN (AAH03377) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TXN monoclonal antibody Western Blot analysis of TXN expression in HeLa.)

Western Blot (WB) (TXN monoclonal antibody Western Blot analysis of TXN expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of TXN expression in transfected 293T cell line by TXN monoclonal antibody. Lane 1: TXN transfected lysate (11.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TXN expression in transfected 293T cell line by TXN monoclonal antibody. Lane 1: TXN transfected lysate (11.7kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TXN on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TXN on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of TXN transfected lysate using TXN monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TXN rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of TXN transfected lysate using TXN monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TXN rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged TXN is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TXN is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TRDX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated Molecular Weight: 12kDa
Observed Molecular Weight: 12kDa
NCBI Official Full Name
Homo sapiens thioredoxin, mRNA
NCBI Official Synonym Full Names
thioredoxin
NCBI Official Symbol
TXN
NCBI Official Synonym Symbols
TRX; TRDX; TRX1
NCBI Protein Information
thioredoxin
UniProt Protein Name
Thioredoxin
Protein Family
UniProt Gene Name
TXN
UniProt Synonym Gene Names
TRDX; TRX; TRX1; Trx; ADF; SASP
UniProt Entry Name
THIO_HUMAN

NCBI Description

The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Research Articles on TRDX

Similar Products

Product Notes

The TRDX txn (Catalog #AAA6150301) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Thioredoxin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRDX txn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Thioredoxin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.