Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (51.74kD).)

Mouse anti-Human, Rat Tumor Necrosis Factor Monoclonal Antibody | anti-TNF antibody

Tumor Necrosis Factor (TNF, TNF-alpha, TNFA, TNF-a, Cachectin, DIF, Tumor Necrosis Factor Ligand Superfamily Member 2, TNFSF2) APC

Gene Names
TNF; DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Tumor Necrosis Factor; Monoclonal Antibody; Tumor Necrosis Factor (TNF; TNF-alpha; TNFA; TNF-a; Cachectin; DIF; Tumor Necrosis Factor Ligand Superfamily Member 2; TNFSF2) APC; anti-TNF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
M1-C4
Specificity
Recognizes human TNF. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TNF antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-234 from human TNF (AAH28148) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (51.74kD).)

Western Blot (WB)

(TNF monoclonal antibody. Western Blot analysis of TNF expression in rat liver.)

Western Blot (WB) (TNF monoclonal antibody. Western Blot analysis of TNF expression in rat liver.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TNF on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TNF on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TNF is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TNF is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-TNF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
25,644 Da
NCBI Official Full Name
Homo sapiens tumor necrosis factor (TNF superfamily, member 2), mRNA
NCBI Official Synonym Full Names
tumor necrosis factor
NCBI Official Symbol
TNF
NCBI Official Synonym Symbols
DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha
NCBI Protein Information
tumor necrosis factor
Protein Family

NCBI Description

This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq, Jul 2008]

Research Articles on TNF

Similar Products

Product Notes

The TNF (Catalog #AAA6139543) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Tumor Necrosis Factor (TNF, TNF-alpha, TNFA, TNF-a, Cachectin, DIF, Tumor Necrosis Factor Ligand Superfamily Member 2, TNFSF2) APC reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Tumor Necrosis Factor can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNF for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.