Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (39.38kD).)

Mouse anti-Human EphA3 Monoclonal Antibody | anti-EphA3 antibody

EphA3 (Ephrin Type-A Receptor 3, Tyrosine-protein Kinase Receptor ETK1, HEK, EPH-like Kinase 4, HEK4, EK4, Tyrosine-protein Kinase TYRO4, ETK, ETK1, HEK, TYRO4) (AP)

Gene Names
EPHA3; EK4; ETK; HEK; ETK1; HEK4; TYRO4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EphA3; Monoclonal Antibody; EphA3 (Ephrin Type-A Receptor 3; Tyrosine-protein Kinase Receptor ETK1; HEK; EPH-like Kinase 4; HEK4; EK4; Tyrosine-protein Kinase TYRO4; ETK; ETK1; TYRO4) (AP); anti-EphA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A12
Specificity
Recognizes human EPHA3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EphA3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa202-326 from human EPHA3 (AAH63282) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (39.38kD).)

Western Blot (WB) (Western Blot detection against Immunogen (39.38kD).)

Western Blot (WB)

(Western Blot analysis of EPHA3 expression in transfected 293T cell line by EPHA3 monoclonal antibody. Lane 1: EPHA3 transfected lysate (110.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EPHA3 expression in transfected 293T cell line by EPHA3 monoclonal antibody. Lane 1: EPHA3 transfected lysate (110.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged EPHA3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EPHA3 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of EPHA3 over-expressed 293 cell line, cotransfected with EPHA3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with EPHA3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of EPHA3 over-expressed 293 cell line, cotransfected with EPHA3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with EPHA3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-EphA3 antibody
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene. It is also known as ETK, HEK, ETK1, HEK4 or TYRO4.
Product Categories/Family for anti-EphA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
72.0 kDa
NCBI Official Full Name
Homo sapiens EPH receptor A3, mRNA
NCBI Official Synonym Full Names
EPH receptor A3
NCBI Official Symbol
EPHA3
NCBI Official Synonym Symbols
EK4; ETK; HEK; ETK1; HEK4; TYRO4
NCBI Protein Information
ephrin type-A receptor 3
Protein Family

NCBI Description

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]

Research Articles on EphA3

Similar Products

Product Notes

The EphA3 (Catalog #AAA6131142) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EphA3 (Ephrin Type-A Receptor 3, Tyrosine-protein Kinase Receptor ETK1, HEK, EPH-like Kinase 4, HEK4, EK4, Tyrosine-protein Kinase TYRO4, ETK, ETK1, HEK, TYRO4) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EphA3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EphA3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EphA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.