<
Western Blot (WB)
(Western Blot detection against Immunogen (55.81kD).)
Mouse anti-Human SNX11 Monoclonal Antibody | anti-SNX11 antibody
SNX11 (Sorting Nexin-11) APC
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNX11; Monoclonal Antibody; SNX11 (Sorting Nexin-11) APC; MGC111019; anti-SNX11 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G1
Specificity
Recognizes human SNX11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SNX11 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-271 from human SNX11 (AAH00768) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (55.81kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (55.81kD).)
Western Blot (WB)
(Western Blot analysis of SNX11 expression in transfected 293T cell line by SNX11 monoclonal antibody. Lane 1: SNX11 transfected lysate (30.4kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of SNX11 expression in transfected 293T cell line by SNX11 monoclonal antibody. Lane 1: SNX11 transfected lysate (30.4kD). Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of SNX11 transfected lysate using SNX11 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SNX11 rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of SNX11 transfected lysate using SNX11 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SNX11 rabbit polyclonal antibody.)
Testing Data
(Detection limit for recombinant GST tagged SNX11 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SNX11 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SNX11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
29,423 Da
NCBI Official Full Name
Homo sapiens sorting nexin 11, mRNA
NCBI Official Synonym Full Names
sorting nexin 11
NCBI Official Symbol
SNX11
NCBI Protein Information
sorting nexin-11
Protein Family
NCBI Description
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. [provided by RefSeq, Jul 2008]
Research Articles on SNX11
Similar Products
Product Notes
The SNX11 (Catalog #AAA6139206) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SNX11 (Sorting Nexin-11) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNX11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNX11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNX11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
