Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.36kD).)

Mouse anti-Human RXRG Monoclonal Antibody | anti-RXRG antibody

RXRG (Retinoic Acid Receptor RXR-gamma, Nuclear Receptor Subfamily 2 Group B Member 3, Retinoid X Receptor gamma, NR2B3) APC

Gene Names
RXRG; RXRC; NR2B3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RXRG; Monoclonal Antibody; RXRG (Retinoic Acid Receptor RXR-gamma; Nuclear Receptor Subfamily 2 Group B Member 3; Retinoid X Receptor gamma; NR2B3) APC; anti-RXRG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6H1
Specificity
Recognizes human RXRG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-RXRG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-76 from human RXRG (NP_008848) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITS*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.36kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.36kD).)

Western Blot (WB)

(Western Blot analysis of RXRG expression in transfected 293T cell line by RXRG monoclonal antibody. Lane 1: RXRG transfected lysate (50.871kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RXRG expression in transfected 293T cell line by RXRG monoclonal antibody. Lane 1: RXRG transfected lysate (50.871kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RXRG is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RXRG is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-RXRG antibody
Retinoid X receptor G (RXRG or RXR gamma) is a nuclear receptor that mediates the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. RXRs as a whole exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulate their transcription. HeLa cell lysate
Product Categories/Family for anti-RXRG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
retinoic acid receptor RXR-gamma isoform a
NCBI Official Synonym Full Names
retinoid X receptor gamma
NCBI Official Symbol
RXRG
NCBI Official Synonym Symbols
RXRC; NR2B3
NCBI Protein Information
retinoic acid receptor RXR-gamma
UniProt Protein Name
Retinoic acid receptor RXR-gamma
Protein Family
UniProt Gene Name
RXRG
UniProt Synonym Gene Names
NR2B3
UniProt Entry Name
RXRG_HUMAN

NCBI Description

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jun 2010]

Uniprot Description

RXRG: Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. The high affinity ligand for RXRs is 9-cis retinoic acid. Homodimer. Heterodimer with a RAR molecule. Binds DNA preferentially as a RAR/RXR heterodimer. Belongs to the nuclear hormone receptor family. NR2 subfamily.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 1q22-q23

Cellular Component: nucleoplasm

Molecular Function: protein binding; retinoid-X receptor activity; zinc ion binding; steroid hormone receptor activity

Biological Process: neuron differentiation; retinoic acid receptor signaling pathway; transcription initiation from RNA polymerase II promoter; skeletal muscle development; response to retinoic acid; regulation of myelination; heart development; gene expression; steroid hormone mediated signaling; transmembrane transport; peripheral nervous system development; protein homotetramerization

Research Articles on RXRG

Similar Products

Product Notes

The RXRG rxrg (Catalog #AAA6138882) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RXRG (Retinoic Acid Receptor RXR-gamma, Nuclear Receptor Subfamily 2 Group B Member 3, Retinoid X Receptor gamma, NR2B3) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RXRG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RXRG rxrg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RXRG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.