Mouse anti-Human PLS1 Monoclonal Antibody | anti-PLS1 antibody

PLS1 (Plastin-1, Intestine-specific Plastin, I-plastin) APC

Cat. Num. AAA6138315

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PLS1; Monoclonal Antibody; PLS1 (Plastin-1; Intestine-specific Plastin; I-plastin) APC; anti-PLS1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G10
• Specificity: Recognizes human PLS1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-PLS1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-103 from PLS1 (NP_002661) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGI
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.96kD).)

Western Blot (WB)

(PLS1 monoclonal antibody. Western Blot analysis of PLS1 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged PLS1 is ~3ng/ml as a capture antibody.)

Product Categories/Family for anti-PLS1 antibody

Antibodies; Plastin

NCBI and Uniprot Product Information

• NCBI GI #: 223718246
• NCBI GeneID: 5357
• NCBI Accession #: NP_002661
• NCBI GenBank Nucleotide #: NM_002670
• UniProt Accession #: Q14651
• Molecular Weight: 70kDa
• NCBI Official Full Name: plastin-1
• NCBI Official Synonym Full Names: plastin 1
• NCBI Official Symbol: PLS1
• NCBI Protein Information: plastin-1
• UniProt Protein Name: Plastin-1
• Protein Family: Plastin
• UniProt Gene Name: PLS1
• UniProt Synonym Gene Names: I-plastin

NCBI Description

Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this gene is a third distinct plastin isoform, which is specifically expressed at high levels in the small intestine. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. A pseudogene of this gene is found on chromosome 11.[provided by RefSeq, Feb 2010]

Uniprot Description

PLS1: Actin-bundling protein in the absence of calcium.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: actin filament; actin filament bundle; brush border; cytoplasm

Molecular Function: actin filament binding; calcium ion binding; structural constituent of cytoskeleton

Biological Process: actin crosslink formation; actin filament bundle formation; actin filament network formation; D-glucose absorption; positive regulation of multicellular organism growth; regulation of microvillus length