Mouse anti-Human PCTK1 Monoclonal Antibody | anti-PCTK1 antibody

PCTK1 (CDK16, Cyclin-dependent Kinase 16, Cell Division Protein Kinase 16, PCTAIRE-motif Protein Kinase 1, Serine/Threonine-protein Kinase PCTAIRE-1, FLJ16665, PCTAIRE, PCTAIRE1, PCTGAIRE) APC

Cat. Num. AAA6138139

• Gene Names: CDK16; PCTK1; PCTAIRE; PCTAIRE1; PCTGAIRE
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PCTK1; Monoclonal Antibody; PCTK1 (CDK16; Cyclin-dependent Kinase 16; Cell Division Protein Kinase 16; PCTAIRE-motif Protein Kinase 1; Serine/Threonine-protein Kinase PCTAIRE-1; FLJ16665; PCTAIRE; PCTAIRE1; PCTGAIRE) APC; anti-PCTK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4D2
• Specificity: Recognizes human PCTK1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 2176

• Applicable Applications for anti-PCTK1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-80 from human PCTK1 (AAH01048) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.21kD).)

Western Blot (WB)

(Western Blot analysis of PCTK1 expression in transfected 293T cell line by PCTK1 monoclonal antibody. Lane 1: PCTK1 transfected lysate (55.7kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PCTK1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)

Product Categories/Family for anti-PCTK1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 33875920
• NCBI GeneID: 5127
• NCBI Official Full Name: Homo sapiens PCTAIRE protein kinase 1, mRNA
• NCBI Official Synonym Full Names: cyclin dependent kinase 16
• NCBI Official Symbol: CDK16
• NCBI Official Synonym Symbols: PCTK1; PCTAIRE; PCTAIRE1; PCTGAIRE
• NCBI Protein Information: cyclin-dependent kinase 16

NCBI Description

The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells; in exocytosis; and in transport of secretory cargo from the endoplasmic reticulum. This gene is thought to escape X inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2009]