Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MTERF Monoclonal Antibody | anti-MTERF antibody

MTERF (Transcription Termination Factor, Mitochondrial, Mitochondrial Transcription Termination Factor 1, mTERF, MGC131634) APC

Gene Names
MTERF1; MTERF
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MTERF; Monoclonal Antibody; MTERF (Transcription Termination Factor; Mitochondrial; Mitochondrial Transcription Termination Factor 1; mTERF; MGC131634) APC; anti-MTERF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A3
Specificity
Recognizes human MTERF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
399
Applicable Applications for anti-MTERF antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from MTERF (NP_008911) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRM*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MTERF antibody
Transcription termination factor. Binds to a 28bp region within the tRNA(Leu(uur)) gene at a position immediately adjacent to and downstream of the 16S rRNA gene; this region comprises a tridecamer sequence critical for directing accurate termination. Binds DNA along the major grove and promotes DNA bending and partial unwinding. Promotes base flipping. Probably requires one or more components for termination activity.
Product Categories/Family for anti-MTERF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
transcription termination factor 1, mitochondrial isoform 1
NCBI Official Synonym Full Names
mitochondrial transcription termination factor 1
NCBI Official Symbol
MTERF1
NCBI Official Synonym Symbols
MTERF
NCBI Protein Information
transcription termination factor 1, mitochondrial
UniProt Protein Name
Transcription termination factor, mitochondrial
UniProt Gene Name
MTERF
UniProt Synonym Gene Names
mTERF
UniProt Entry Name
MTERF_HUMAN

NCBI Description

This gene encodes a mitochondrial transcription termination factor. This protein participates in attenuating transcription from the mitochondrial genome; this attenuation allows higher levels of expression of 16S ribosomal RNA relative to the tRNA gene downstream. The product of this gene has three leucine zipper motifs bracketed by two basic domains that are all required for DNA binding. There is evidence that, for this protein, the zippers participate in intramolecular interactions that establish the three-dimensional structure required for DNA binding. [provided by RefSeq, Jul 2008]

Uniprot Description

MTERF: Transcription termination factor. Binds to a 28 bp region within the tRNA(Leu(uur)) gene at a position immediately adjacent to and downstream of the 16S rRNA gene; this region comprises a tridecamer sequence critical for directing accurate termination. Binds DNA along the major grove and promotes DNA bending and partial unwinding. Promotes base flipping. Probably requires one or more components for termination activity. Belongs to the mTERF family.

Chromosomal Location of Human Ortholog: 7q21.2

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: protein binding; double-stranded DNA binding

Biological Process: termination of mitochondrial transcription; mitochondrion organization and biogenesis; regulation of transcription, DNA-dependent; organelle organization and biogenesis; gene expression; transcription termination; DNA geometric change; transcription from mitochondrial promoter

Research Articles on MTERF

Similar Products

Product Notes

The MTERF mterf (Catalog #AAA6137714) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MTERF (Transcription Termination Factor, Mitochondrial, Mitochondrial Transcription Termination Factor 1, mTERF, MGC131634) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTERF can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MTERF mterf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MTERF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.