Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (47.74kD).)

Mouse anti-Human ITGB1BP1 Monoclonal Antibody | anti-ITGB1BP1 antibody

ITGB1BP1 (ICAP1, Integrin beta-1-binding Protein 1, Integrin Cytoplasmic Domain-associated Protein 1, ICAP-1) APC

Gene Names
ITGB1BP1; ICAP1; ICAP1A; ICAP1B; ICAP-1A; ICAP-1B; ICAP-1alpha
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITGB1BP1; Monoclonal Antibody; ITGB1BP1 (ICAP1; Integrin beta-1-binding Protein 1; Integrin Cytoplasmic Domain-associated Protein 1; ICAP-1) APC; anti-ITGB1BP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B2
Specificity
Recognizes human ITGB1BP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ITGB1BP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-200 from ITGB1BP1 (AAH12264) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (47.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (47.74kD).)

Western Blot (WB)

(Western Blot analysis of ITGB1BP1 expression in transfected 293T cell line by ITGB1BP1 monoclonal antibody. Lane 1: ITGB1BP1 transfected lysate (21.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ITGB1BP1 expression in transfected 293T cell line by ITGB1BP1 monoclonal antibody. Lane 1: ITGB1BP1 transfected lysate (21.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ITGB1BP1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ITGB1BP1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-ITGB1BP1 antibody
The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein are derived from alternatively spliced transcripts. The shorter form of this protein does not interact with the beta1 integrin cytoplasmic domain. The longer form is a phosphoprotein and the extent of its phosphorylation is regulated by the cell-matrix interaction, suggesting an important role of this protein during integrin-dependent cell adhesion.
Product Categories/Family for anti-ITGB1BP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
16,140 Da
NCBI Official Full Name
Homo sapiens integrin beta 1 binding protein 1, mRNA
NCBI Official Synonym Full Names
integrin subunit beta 1 binding protein 1
NCBI Official Symbol
ITGB1BP1
NCBI Official Synonym Symbols
ICAP1; ICAP1A; ICAP1B; ICAP-1A; ICAP-1B; ICAP-1alpha
NCBI Protein Information
integrin beta-1-binding protein 1

NCBI Description

The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein are derived from alternatively spliced transcripts. The shorter form of this protein does not interact with the beta1 integrin cytoplasmic domain. The longer form is a phosphoprotein and the extent of its phosphorylation is regulated by the cell-matrix interaction, suggesting an important role of this protein during integrin-dependent cell adhesion. Several transcript variants, some protein-coding and some non-protein coding, have been found for this gene. [provided by RefSeq, Jan 2016]

Research Articles on ITGB1BP1

Similar Products

Product Notes

The ITGB1BP1 (Catalog #AAA6137223) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITGB1BP1 (ICAP1, Integrin beta-1-binding Protein 1, Integrin Cytoplasmic Domain-associated Protein 1, ICAP-1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB1BP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITGB1BP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGB1BP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.