Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (43.78kD).)

Mouse anti-Human Interleukin 18BP Monoclonal Antibody | anti-IL18BP antibody

Interleukin 18BP (Interleukin 18 Binding Protein, IL-18BP, IL18BP, IL18BPa, Tadekinig-alfa, Interleukin-18-binding Protein) APC

Gene Names
IL18BP; IL18BPa
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Interleukin 18BP; Monoclonal Antibody; Interleukin 18BP (Interleukin 18 Binding Protein; IL-18BP; IL18BP; IL18BPa; Tadekinig-alfa; Interleukin-18-binding Protein) APC; anti-IL18BP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2A9
Specificity
Recognizes human IL18BP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-IL18BP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa31-194 from IL18BP (AAH44215) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (43.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (43.78kD).)

Testing Data

(Detection limit for recombinant GST tagged IL18BP is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IL18BP is ~3ng/ml as a capture antibody.)
Related Product Information for anti-IL18BP antibody
The protein encoded by this gene is an inhibitor of the proinflammatory cytokine IL18. This protein binds to IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production. This protein is constitutively expressed and secreted in mononuclear cells. The expression of this protein can be enhanced by IFN-gamma. An elevated level of this protein is detected in the intestinal tissues of patients with Crohn disease. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-IL18BP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
17,478 Da
NCBI Official Full Name
Homo sapiens interleukin 18 binding protein, mRNA
NCBI Official Synonym Full Names
interleukin 18 binding protein
NCBI Official Symbol
IL18BP
NCBI Official Synonym Symbols
IL18BPa
NCBI Protein Information
interleukin-18-binding protein

NCBI Description

The protein encoded by this gene functions as an inhibitor of the proinflammatory cytokine, IL18. It binds IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2011]

Research Articles on IL18BP

Similar Products

Product Notes

The IL18BP (Catalog #AAA6137186) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Interleukin 18BP (Interleukin 18 Binding Protein, IL-18BP, IL18BP, IL18BPa, Tadekinig-alfa, Interleukin-18-binding Protein) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Interleukin 18BP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL18BP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Interleukin 18BP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.