Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human IL2RA Monoclonal Antibody | anti-IL2RA antibody

IL2RA (Interleukin-2 Receptor Subunit alpha, IL-2 Receptor Subunit alpha, IL-2-RA, IL-2R Subunit alpha, IL2-RA, TAC Antigen, p55, CD25) APC

Gene Names
IL2RA; p55; CD25; IL2R; IMD41; TCGFR; IDDM10
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL2RA; Monoclonal Antibody; IL2RA (Interleukin-2 Receptor Subunit alpha; IL-2 Receptor Subunit alpha; IL-2-RA; IL-2R Subunit alpha; IL2-RA; TAC Antigen; p55; CD25) APC; anti-IL2RA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D6
Specificity
Recognizes human IL2RA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-IL2RA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa22-122 from human IL2RA (NP_000408) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-IL2RA antibody
IL-2 receptor alpha (IL-2 RA), also known as CD25, is a 55kD type I membrane glycoprotein that belongs to a family of cytokine receptors that utilize the common gamma chain subunit (Gc). IL-2 RA is primarily expressed on activated T cells and on regulatory T cells (Treg). IL-2 RABBIT (CD122) and Gc (IL-2 RG/CD132) dimerize to form a constitutively expressed intermediate affinity IL-2 receptor. By itself, IL-2 RA binds IL-2 with low affinity. It associates with IL-2 RB and GC to generate a ternary high affinity IL-2 receptor complex. A soluble form of IL-2 RA can be generated by proteolytic cleavage of the cell surface receptor, rendering the T cell unresponsive to IL-2. Increased serum levels of soluble IL-2 RA are found in some cancers and immune disorders. IL-2 RA is required for activation-induced cell death (AICD) of naive T cells, a mechanism responsible for deleting autoreactive T cell clones. IL-2 RA is also required for the development of CD4+CD25+ Treg which suppress autoreactive CD4+ T cells, thereby contributing to peripheral T cell homeostasis. Within the ECD, canine IL-2 RA shares 49%-60% aa sequence identity with human, mouse, and rat IL-2 RA.
Product Categories/Family for anti-IL2RA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52.1kDa (461aa) 50-70kDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
interleukin-2 receptor subunit alpha isoform 1
NCBI Official Synonym Full Names
interleukin 2 receptor subunit alpha
NCBI Official Symbol
IL2RA
NCBI Official Synonym Symbols
p55; CD25; IL2R; IMD41; TCGFR; IDDM10
NCBI Protein Information
interleukin-2 receptor subunit alpha
UniProt Protein Name
Interleukin-2 receptor subunit alpha
Protein Family
UniProt Gene Name
IL2RA
UniProt Synonym Gene Names
IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA
UniProt Entry Name
IL2RA_HUMAN

NCBI Description

The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency.[provided by RefSeq, Nov 2009]

Uniprot Description

IL2RA: Receptor for interleukin-2. Non-covalent dimer of an alpha and a beta subunit. IL2R exists in 3 different forms: a high affinity dimer, an intermediate affinity monomer (beta subunit), and a low affinity monomer (alpha subunit). The high and intermediate affinity forms also associate with a gamma subunit.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 10p15-p14

Cellular Component: integral to membrane; plasma membrane; external side of plasma membrane

Molecular Function: interleukin-2 receptor activity; drug binding; interleukin-2 binding

Biological Process: Notch signaling pathway; regulation of T cell homeostatic proliferation; apoptosis; negative regulation of immune response; negative regulation of defense response to virus; positive regulation of activated T cell proliferation; cell proliferation; negative regulation of T cell proliferation; inflammatory response to antigenic stimulus; cell surface receptor linked signal transduction; positive regulation of T cell differentiation; negative regulation of inflammatory response; immune response; inflammatory response; activated T cell apoptosis

Disease: Interleukin 2 Receptor, Alpha, Deficiency Of; Diabetes Mellitus, Insulin-dependent, 10

Research Articles on IL2RA

Similar Products

Product Notes

The IL2RA il2ra (Catalog #AAA6137164) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL2RA (Interleukin-2 Receptor Subunit alpha, IL-2 Receptor Subunit alpha, IL-2-RA, IL-2R Subunit alpha, IL2-RA, TAC Antigen, p55, CD25) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL2RA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL2RA il2ra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL2RA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.