Mouse anti-Human HMGB1 Monoclonal Antibody | anti-HMGB1 antibody

HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1) APC

Cat. Num. AAA6137001

• Gene Names: HMGB1; HMG1; HMG3; SBP-1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HMGB1; Monoclonal Antibody; HMGB1 (High Mobility Group Protein B1; High Mobility Group Protein 1; HMG-1; HMG1) APC; anti-HMGB1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D5
• Specificity: Recognizes human HMGB1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-HMGB1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-215 from human HMGB1 (AAH03378.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (49.39kD).)

Western Blot (WB)

(HMGB1 monoclonal antibody Western Blot analysis of HMGB1 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody Lane 1: HMGB1 transfected lysate (24.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma tissue. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-HMGB1 antibody

Antibodies; Binding Proteins

References

1. TLR4, IL-6, IL-18, MyD88 and HMGB1 are highly expressed in intracranial inflammatory lesions and the IgG4/IgG ratio correlates with TLR4 and IL-6. Hirano H, Yoshioka T, Yunoue S, Fujio S, Yonezawa H, Niiro T, Habu M, Oyoshi T, Sugata S, Kamezawa T, Arimura H, Hanaya R, Tokimura H, Tokudome M, Arita K.Neuropathology. 2012 Mar 13. doi: 10.1111/j.1440-1789.2012.01310.x. 2. Human IgG antibody profiles differentiate between symptomatic patients with and without colorectal cancer. Kijanka G, Hector S, Kay EW, Murray F, Cummins R, Murphy D, Maccraith BD, Prehn JH, Kenny D.Gut. 2010 Jan;59(1):69-78. 3. Donor Toll-like receptor 4 contributes to ischemia and reperfusion injury following human kidney transplantation. Kruger B, Krick S, Dhillon N, Lerner SM, Ames S, Bromberg JS, Lin M, Walsh L, Vella J, Fischereder M, Kramer BK, Colvin RB, Heeger PS, Murphy BT, Schroppel B.Proc Natl Acad Sci U S A. 2009 Mar 3;106(9):3390-5. Epub 2009 Feb 13.

NCBI and Uniprot Product Information

• NCBI GI #: 13097233
• NCBI GeneID: 3146
• UniProt Accession #: P09429; Q14321; Q5T7C3; Q6IBE1; A5D8W9
• Molecular Weight: 24,894 Da
• NCBI Official Full Name: Homo sapiens high-mobility group box 1, mRNA
• NCBI Official Synonym Full Names: high mobility group box 1
• NCBI Official Symbol: HMGB1
• NCBI Official Synonym Symbols: HMG1; HMG3; SBP-1
• NCBI Protein Information: high mobility group protein B1; HMG-1; Amphoterin; high-mobility group box 1; high mobility group protein 1; Sulfoglucuronyl carbohydrate binding protein; high-mobility group (nonhistone chromosomal) protein 1
• UniProt Protein Name: High mobility group protein B1
• Protein Family: High mobility group protein
• UniProt Gene Name: HMGB1
• UniProt Synonym Gene Names: HMG1; HMG-1
• UniProt Entry Name: HMGB1_HUMAN

Uniprot Description

HMGB1: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Component of the RAG complex composed of core components RAG1 and RAG2, and associated component HMGB1 or HMGB2. Belongs to the HMGB family.

Protein type: DNA repair, damage; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: nucleoplasm; extracellular space; cell surface; transcriptional repressor complex; extracellular region; condensed chromosome; nucleus

Molecular Function: protein binding; RAGE receptor binding; double-stranded DNA binding; damaged DNA binding; cytokine activity; chromatin binding; transcription factor activity; DNA bending activity; transcription factor binding; single-stranded DNA binding; chemoattractant activity

Biological Process: negative regulation of transcriptional preinitiation complex assembly; DNA topological change; V(D)J recombination; apoptosis; positive regulation of apoptosis; positive regulation of caspase activity; base-excision repair, DNA ligation; negative regulation of transcription from RNA polymerase II promoter; DNA recombination; chromatin remodeling; regulation of transcription from RNA polymerase II promoter; myeloid dendritic cell activation; inflammatory response to antigenic stimulus; positive chemotaxis; dendritic cell chemotaxis; innate immune response; DNA ligation during DNA repair; positive regulation of transcription from RNA polymerase II promoter; DNA fragmentation during apoptosis; neurite development; cell structure disassembly during apoptosis; positive regulation of DNA binding