Western Blot (WB)
(Western Blot detection against Immunogen (38.1kD).)
Mouse anti-Human G-Protein Coupled Receptor 84 Monoclonal Antibody | anti-GPR84 antibody
G-Protein Coupled Receptor 84 (GPR84, EX33, GPCR4, Inflammation-related G-protein Coupled Receptor) APC
Gene Names
GPR84; EX33; GPCR4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
G-Protein Coupled Receptor 84; Monoclonal Antibody; G-Protein Coupled Receptor 84 (GPR84; EX33; GPCR4; Inflammation-related G-protein Coupled Receptor) APC; anti-GPR84 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B7
Specificity
Recognizes human GPR84.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-GPR84 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa209-317 from human GPR84 (NP_065103) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.1kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.1kD).)
Testing Data
(Detection limit for recombinant GST tagged GPR84 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged GPR84 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-GPR84 antibody
G protein-coupled receptor EX33 is an Orphan-A GPCR with an unknown ligand. ESTs have been isolated from blood and brain libraries.
Product Categories/Family for anti-GPR84 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
G-protein coupled receptor 84
NCBI Official Synonym Full Names
G protein-coupled receptor 84
NCBI Official Symbol
GPR84
NCBI Official Synonym Symbols
EX33; GPCR4
NCBI Protein Information
G-protein coupled receptor 84
UniProt Protein Name
G-protein coupled receptor 84
Protein Family
UniProt Gene Name
GPR84
UniProt Synonym Gene Names
EX33
UniProt Entry Name
GPR84_HUMAN
Uniprot Description
GPR84: Receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. Not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G(i/o) protein pathway. May have important roles in processes from fatty acid metabolism to regulation of the immune system. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, multi-pass; Motility/polarity/chemotaxis; GPCR, family 1; Receptor, GPCR; Membrane protein, integral
Chromosomal Location of Human Ortholog: 12q13.13
Cellular Component: plasma membrane; integral to membrane; receptor complex
Molecular Function: G-protein coupled receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway
Research Articles on GPR84
Similar Products
Product Notes
The GPR84 gpr84 (Catalog #AAA6136693) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The G-Protein Coupled Receptor 84 (GPR84, EX33, GPCR4, Inflammation-related G-protein Coupled Receptor) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's G-Protein Coupled Receptor 84 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GPR84 gpr84 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "G-Protein Coupled Receptor 84, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
