Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Rat lung, using ARHGEF10L antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Human, Rat ARHGEF10L Polyclonal Antibody | anti-ARHGEF10L antibody

ARHGEF10L Rabbit pAb

Gene Names
ARHGEF10L; GrinchGEF
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
ARHGEF10L; Polyclonal Antibody; ARHGEF10L Rabbit pAb; GrinchGEF; anti-ARHGEF10L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
SHVGRELTRKKGILLQYRLRSTAHLPGPLLSMREPAPADGAALEHSEEDGSIYEMADDPDIWVRSRPCARDAHRKEICSVAIISGGQGYRNFGSALGSSGRQAPCGETDST
Applicable Applications for anti-ARHGEF10L antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1120-1230 of human ARHGEF10L (NP_001011722).
Positive Samples
Rat lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Rat lung, using ARHGEF10L antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of Rat lung, using ARHGEF10L antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-ARHGEF10L antibody
Background: This gene belongs to the RhoGEF subfamily of RhoGTPases. Members of this subfamily are activated by specific guanine nucleotide exchange factors (GEFs) and are involved in signal transduction. The encoded protein shows cytosolic distribution. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2016]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140,409 Da
NCBI Official Full Name
rho guanine nucleotide exchange factor 10-like protein isoform 2
NCBI Official Synonym Full Names
Rho guanine nucleotide exchange factor (GEF) 10-like
NCBI Official Symbol
ARHGEF10L
NCBI Official Synonym Symbols
GrinchGEF
NCBI Protein Information
rho guanine nucleotide exchange factor 10-like protein
UniProt Protein Name
Rho guanine nucleotide exchange factor 10-like protein
UniProt Gene Name
ARHGEF10L
UniProt Synonym Gene Names
GRINCHGEF; KIAA1626
UniProt Entry Name
ARGAL_HUMAN

Similar Products

Product Notes

The ARHGEF10L arhgef10l (Catalog #AAA9142960) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGEF10L Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGEF10L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ARHGEF10L arhgef10l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SHVGRELTRK KGILLQYRLR STAHLPGPLL SMREPAPADG AALEHSEEDG SIYEMADDPD IWVRSRPCAR DAHRKEICSV AIISGGQGYR NFGSALGSSG RQAPCGETDS T. It is sometimes possible for the material contained within the vial of "ARHGEF10L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.