Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Mouse anti-Human UBA6 Monoclonal Antibody | anti-UBA6 antibody

UBA6 (Ubiquitin-like Modifier-activating Enzyme 6, Ubiquitin Activating Enzyme 6, E1-L2, FLJ10808, FLJ23367, Monocyte Protein 4, MOP4, MOP-4, Ubiquitin-activating Enzyme E1-like Protein 2, UBE1L2, FLJ10808, FLJ23367, MOP-4, UBE1L2) APC

Gene Names
UBA6; E1-L2; MOP-4; UBE1L2
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBA6; Monoclonal Antibody; UBA6 (Ubiquitin-like Modifier-activating Enzyme 6; Ubiquitin Activating Enzyme 6; E1-L2; FLJ10808; FLJ23367; Monocyte Protein 4; MOP4; MOP-4; Ubiquitin-activating Enzyme E1-like Protein 2; UBE1L2; UBE1L2) APC; anti-UBA6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1D11
Specificity
Recognizes human FLJ10808.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-UBA6 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa962-1052 from human FLJ10808 (NP_060697) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPTTEKKYVDLTVSFAPDIDGDEDLPGPPVRYYFSHDT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to UBA6 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to UBA6 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged UBA6 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBA6 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-UBA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,693 Da
NCBI Official Full Name
ubiquitin-like modifier-activating enzyme 6
NCBI Official Synonym Full Names
ubiquitin-like modifier activating enzyme 6
NCBI Official Symbol
UBA6
NCBI Official Synonym Symbols
E1-L2; MOP-4; UBE1L2
NCBI Protein Information
ubiquitin-like modifier-activating enzyme 6; UBA6, ubiquitin-activating enzyme E1; monocyte protein 4; ubiquitin-activating enzyme 6; ubiquitin-activating enzyme E1-like 2; ubiquitin-activating enzyme E1-like protein 2
UniProt Protein Name
Ubiquitin-like modifier-activating enzyme 6
UniProt Gene Name
UBA6
UniProt Synonym Gene Names
MOP4; UBE1L2; Ubiquitin-activating enzyme 6; MOP-4; E1-L2
UniProt Entry Name
UBA6_HUMAN

Uniprot Description

UBE1L2: Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin- E1 thioester and free AMP. Specific for ubiquitin, does not activate ubiquitin-like peptides. Differs from UBE1 in its specificity for substrate E2 charging. Does not charge cell cycle E2s, such as CDC34. Essential for embryonic development. Required for UBD/FAT10 conjugation. Isoform 2 may play a key role in ubiquitin system and may influence spermatogenesis and male fertility. Belongs to the ubiquitin-activating E1 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin ligase; EC 6.3.2.19; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 4q13.2

Cellular Component: cytoplasm; cytosol

Molecular Function: protein binding; FAT10 activating enzyme activity; ATP binding

Biological Process: ubiquitin-dependent protein catabolic process; protein ubiquitination

Similar Products

Product Notes

The UBA6 uba6 (Catalog #AAA6136618) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBA6 (Ubiquitin-like Modifier-activating Enzyme 6, Ubiquitin Activating Enzyme 6, E1-L2, FLJ10808, FLJ23367, Monocyte Protein 4, MOP4, MOP-4, Ubiquitin-activating Enzyme E1-like Protein 2, UBE1L2, FLJ10808, FLJ23367, MOP-4, UBE1L2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBA6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBA6 uba6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBA6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.